Identifiers and Description

Gene Model Identifier

Contig9380.0.g29

Standard Name

RPA1c

Aliases

Contig9380_0_g29

Description

Replication factor-A C terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYAR007C4.999350823993609e-33RFA1 SGDID:S000000065, Chr I f
rom 158619-156754, Genome...
T. thermophilaTTHERM_001068901.000382677035467e-28hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9380.0.g29(coding)
ATGAACTCGGATCGTTAATCCATGGTCTCTAACCAGACAGCCTCCACGGCTCAATCAAAC
CGATTTAATCAGGGAGATATGACAAATGACCCCTTAAATCATGGATTTCTTTAATAAAAT
GAAATTTAAACTTATTCCCCTTAAGACCTCTAAAAATTGAAAGCCAATTACCCTAACCTC
TCTTAAAACGGCATTTTTCTATTAAACTAGCTGCCAGATAAGGAGAAGTTTAAGGGGCAG
TCAATGATTTTATAGATTGTTAGCGAATAGATAATTGCTAATAATAGAAATGAGAATAGC
AATGATCCTCAACAAATGGCGAAAGTTTTTAGAGCTAAATACACAATTAGTGATGGAAAT
CTAAGTACTAAGTCAGTGATTCAAGCTTTAGTTTATGATGATCTATAAGAAAAGCCTAAG
CTCTGGGATATAGTCAAAATCGATTCTTTGATAAAAATGGTTATATAGGGATAAATGCTT
ATAATTTTGAGAAACATAAAAGTGTTATACTCAGGGTTAACTTAAGCAATTGGCTCACCT
ATAGATATAAAGAAGGCGTTGTAAAACGGTGATGACTTGAGCAACTTGTAACCAGTCCAA
ATCCCCTATCCAATTCAAAACTCCCACTCCTAAACAAATACTTTATCTCAATCTTCTTAG
AAGAGATAGTATCTGAATATAAGCGGGGAATAGGCTCAGAGTCAGACAAGAAATAATAAT
TCTGGAGGTGCTTACAATTTCATAAAGCCTCCAACTCCTGACCAATAATTCAATAATAGA
TAAAACTTTGGTAAAACATCTCTGGGTGATCAACTCCCCAATACCTCAAGCTCAAGTAAA
GACAAGTATTAAAACTCAGTATTTGCACAAAAACAATAAAATTAAACTCTCTCATCATCT
GAAGCAAATATCATGCCAATCAAAGCTCTAAATACCTTCTCAAGAGACTGGAAAATATAG
GCAAGAATCGTTTAAAAAAGTGATAAGAGACAGACTAAAAACGGGGGCAGCTTATTAAAG
ATGGAAATTGTAGATCGATATAATACACCCATAGAGGCTACGTTTTTCAATGATGCGGCT
GATTTCTTTGAACATAAGATACATGTCGGGAAAGTTTATGATTTTTGTGATGGCAGCATC
AAATTAGCAAACAAAAAGTTTACTACAGTAAAAAACGATTTTACTCTTACATTTGAGAAG
AGCTCTCAAATCACCGAAGTTGCAGACGATGGTTCAATTTCTCAAGAAACCTTCGAATAT
TAACCAATTTCGAAGTGTGAAGACTTAACAGTAGGTGCAAGTATCGATTTAATAGGTGTA
GTTTTAGACATTACTTCCTGTGATACAATCAAACTCAAGAATAACAGATAGAAGCAACGA
AGATACATCACAATTATCGACGAATCGTTTTGCTCTATCAGTTTGACAATTTGGGGCGAA
GGATTTTGCTAAAGAATGAACGAAGTCGGGTAGGGAGATATTTTGGCTATGAAAGGAGGC
AGACTTAGTGAATTTGGAGGGAAAACAATCAATGTGGCTGATGATCATGCAAGCATAATG
GTTAATCCCAGCAACCCAAGAGGCAAGAAGGTATATGATTGGTATATTCAGCAGGTACAG
GGTGGAGAGGAAAGCATGAAACAGATCAAACACTTAAGTAATTTACAAAGTAGTAGGAGT
GATAAGGCTGAACTCAATGTGGTTGACTAATCTAATGATAAGCAAAGAAGAAATCAACTT
AATTTTATCTGTGAAATAACATCGATGTTGCAAGATGAGAATGATGTAGACCAGCAACAC
TTTTTCTTCTTAAATGGCTACATATCGCTGATTAAAAATGATGATAAAATATTCTACATT
GCTTGTCCAAATGATAATTGCAGGAGAAAAGTTACTGAAGAGCATCAATAACAAGGGCAA
GCATATAGATGTGAAGCTTGCAATAAAGTTTATAGAACATGCTAACCTACATATATGATT
CAAGCAAAAATTACAGATTTCACAGACACCATATACATCAATTTCCCTCGTGATAACGGA
ACCGCTCTAATGGGCATGACAGCTTAAGAATTCAAACACTTCAGAGATAGAGCCACAGAA
GAAGAACTTTCTGCATATTTCGATTCTCTTCTCTTCAAGCAATTCAACATTATGGTGAAG
GGTAAATTCGAATTTTATGGGGGTGAAAATAGAATGCGATTCTTTGCCATTAAAGTGTTC
CCAATCAAGGAAGTTATGAGCGAGAATAGAGCCTTGATTAAAAGACTAGATGTATACAAG
GATATAGAACCAAAGTGCAATTCGTTATGA


>Contig9380.0.g29(protein)
MNSDRQSMVSNQTASTAQSNRFNQGDMTNDPLNHGFLQQNEIQTYSPQDLQKLKANYPNL
SQNGIFLLNQLPDKEKFKGQSMILQIVSEQIIANNRNENSNDPQQMAKVFRAKYTISDGN
LSTKSVIQALVYDDLQEKPKLWDIVKIDSLIKMVIQGQMLIILRNIKVLYSGLTQAIGSP
IDIKKALQNGDDLSNLQPVQIPYPIQNSHSQTNTLSQSSQKRQYLNISGEQAQSQTRNNN
SGGAYNFIKPPTPDQQFNNRQNFGKTSLGDQLPNTSSSSKDKYQNSVFAQKQQNQTLSSS
EANIMPIKALNTFSRDWKIQARIVQKSDKRQTKNGGSLLKMEIVDRYNTPIEATFFNDAA
DFFEHKIHVGKVYDFCDGSIKLANKKFTTVKNDFTLTFEKSSQITEVADDGSISQETFEY
QPISKCEDLTVGASIDLIGVVLDITSCDTIKLKNNRQKQRRYITIIDESFCSISLTIWGE
GFCQRMNEVGQGDILAMKGGRLSEFGGKTINVADDHASIMVNPSNPRGKKVYDWYIQQVQ
GGEESMKQIKHLSNLQSSRSDKAELNVVDQSNDKQRRNQLNFICEITSMLQDENDVDQQH
FFFLNGYISLIKNDDKIFYIACPNDNCRRKVTEEHQQQGQAYRCEACNKVYRTCQPTYMI
QAKITDFTDTIYINFPRDNGTALMGMTAQEFKHFRDRATEEELSAYFDSLLFKQFNIMVK
GKFEFYGGENRMRFFAIKVFPIKEVMSENRALIKRLDVYKDIEPKCNSL