Identifiers and Description

Gene Model Identifier

Contig2420.0.g63

Standard Name

RPA1b

Aliases

Contig2420_0_g63

Description

Replication factor-A C terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam08646 ) Replication factor-A C terminal domain
  • ( pfam04057 ) Replication factor-A protein 1, N-terminal domain
  • ( pfam01336 ) OB-fold nucleic acid binding domain
  • ( pfam02721 ) Domain of unknown function DUF223
  • ( pfam09103 ) BRCA2, oligonucleotide/oligosaccharide-binding, domain 1
  • ( pfam07191 ) Protein of unknown function (DUF1407)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYAR007C8.999599844922746e-55RFA1 SGDID:S000000065, Chr I f
rom 158619-156754, Genome...
T. thermophilaTTHERM_001068903.0010664139725277e-29hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2420.0.g63(coding)
ATGAGCGCAATAACTCATCTCACTGCAAACGGTATCAAGACTATTGCTGAATGCCAAAAC
CATCAACAACAACTAAGAGACTAGCTTTTTGTTGTCCAGATCATTGATGTAAAGATTATG
TCACAGGAAGAAAACAAAAAGAACGTCAAAGCAAGAATCACACTCTCTGATGGAGTCTCA
TCAATTGTTTCAATGTTCACTGATAAAATTTACAAACTCCTTAATGGAAGAGAACTTGAG
AAGTACTCAATCATTAGAATTAACGGAGGATTAGTGTAAATTAATCCAGTGTAGAACAGA
TTAAACATCGGGTCTCCAGCTGATTATACTGTAAACTAGCAGAAAGCCAACTTTTCTACT
GCATCAGTAGACTTGAAAATCCCTTTGAATGAGACTGATTAAAAGGTTGCATTTAGAGAT
GAACAGGAAAGTCTCGATGACGATGTTCTTGATAACATTGCCAACTAGATACAGTAGCAG
CAGCAAAACAGAAATCCATCTGGCTAACTGAGTAACAACTTTGAAAGAATGGGCATTAGA
TCACCTATCAATCAAAATAATAATGATCCATAGAATGATTATAATGCCAGACAGAGTGGT
GTTAACAACAATCAAGGTAGAATGATGCCTAGTTCTATGATCAACAACTAGAACAGACAA
TCTGACTATGATGGCAATAGAAGCAAGAGAATGAGTTCTATTCAAGAGATGTATACACCT
ATCAGAATGCTAAATAATTTCACCAAGGATTGGAAGATCAAAGCAAGAGTTATCTAGAAA
GGTCAAAAGAAAGAATGGAGGAATGCAAAAGGTGAAGGAGTTCTACTCAATGCTGATCTT
ATTGATCACGAGGGAACTCAAATTCAAGCAACTTTCTTTGGAGAGGCAGCACACAAATAT
GATTAGATGCTTCATGAAAATCATGTGTATTTGTTCTCAAATGGCTAGGTAAAGATAGCC
AACAAGAAATTTACATCAATCAAGAATGATCACTGCTTAACTTTTGATCAAAATGCAGAG
ATTTCTGAGGTCCAGGATGACAACTAAATCAAGAGTTAAGGATTCTCTTTTGTAACTTTG
AGAAATATTGAGAAGGTAATGGCTGGCCAAGCAATTGATGTTATCGGAGTTATTACTGAG
ATTAGCAACACCTCATCTATTCCTTTGAAAAGCGGCTAAAACAAAGATAGAAGAAACATT
ACTATCGCAGATGAAAGTGAAGCTAAGATTTCGCTTAGTCTTTGGGGTAACTTGTGCACT
CAGTATAGCTATGAGGAAGGTTAAGTTATGGCAGTTAAGAATGTAAGAGTTTCTGACTAT
GGTGGAAAATCTTTGAATTGCGGTGATGATCACTCTCTTATTTATCTAAATCCAGCTGAT
AAGAGAACTGACTAGTTAATGTAATGGAGTTAGACAGGTGGAGCTAAAAAGAATCTTCAA
AACCTATCAGGAGGAGTAGGAGGAGGAGATTCAGGCTCAAGAGACAACTATAGACTAGTG
AGAGAGATGTCAGACACTTTATTACATGAAAACTCTGATAGAAATGACAAAACTGCTCCT
CAATATTTCAAACTTAGTGGTTATATAAGCAAGATTCTTTATGATGAAAACAGGATGATG
TATTTCCCAGGATGCCCTGAATGCAAAAAGAAATGTTCTCCATAGGGAGATCAGTACTGG
TGCGAAAAATGTAACAAAGCATTGAATCACAACTAAGTCAGGATGACTTATACTGTTACA
GCCAAGTTTGATGATCTCTCAGATGGAATTTTCATAAGTTTCATGAGTGAGAGTGCAGAA
CCTATTATGGGTATGCCTGCTTCAGACTTCTCAAGAATTCGTGAGGACTAGTCAAACTCT
TTGGAATTCATTAGAGATTTGTTGAATGAGAAAAGCTTTAACTACTATACTTTTGTAGTT
AAGGCTGCATTAGACGACTATAACATAAATGAGGCCAGATTCAAGTATTAAGCTGTCAGA
AGTCAACCACTAGATATGAATGAAGAGAATCAGATGTTACTCAGAAGATTGAACTTATAC
AAGAAAAAGCAGTGA


>Contig2420.0.g63(protein)
MSAITHLTANGIKTIAECQNHQQQLRDQLFVVQIIDVKIMSQEENKKNVKARITLSDGVS
SIVSMFTDKIYKLLNGRELEKYSIIRINGGLVQINPVQNRLNIGSPADYTVNQQKANFST
ASVDLKIPLNETDQKVAFRDEQESLDDDVLDNIANQIQQQQQNRNPSGQLSNNFERMGIR
SPINQNNNDPQNDYNARQSGVNNNQGRMMPSSMINNQNRQSDYDGNRSKRMSSIQEMYTP
IRMLNNFTKDWKIKARVIQKGQKKEWRNAKGEGVLLNADLIDHEGTQIQATFFGEAAHKY
DQMLHENHVYLFSNGQVKIANKKFTSIKNDHCLTFDQNAEISEVQDDNQIKSQGFSFVTL
RNIEKVMAGQAIDVIGVITEISNTSSIPLKSGQNKDRRNITIADESEAKISLSLWGNLCT
QYSYEEGQVMAVKNVRVSDYGGKSLNCGDDHSLIYLNPADKRTDQLMQWSQTGGAKKNLQ
NLSGGVGGGDSGSRDNYRLVREMSDTLLHENSDRNDKTAPQYFKLSGYISKILYDENRMM
YFPGCPECKKKCSPQGDQYWCEKCNKALNHNQVRMTYTVTAKFDDLSDGIFISFMSESAE
PIMGMPASDFSRIREDQSNSLEFIRDLLNEKSFNYYTFVVKAALDDYNINEARFKYQAVR
SQPLDMNEENQMLLRRLNLYKKKQ