Identifiers and Description

Gene Model Identifier

Contig5713.0.g13

Standard Name

RPA1a

Aliases

Contig5713_0_g13

Description

Replication factor-A C terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam08646 ) Replication factor-A C terminal domain
  • ( pfam04057 ) Replication factor-A protein 1, N-terminal domain
  • ( pfam02721 ) Domain of unknown function DUF223
  • ( pfam07191 ) Protein of unknown function (DUF1407)
  • ( pfam09103 ) BRCA2, oligonucleotide/oligosaccharide-binding, domain 1
  • ( pfam00096 ) Zinc finger, C2H2 type
  • ( pfam08209 ) Sgf11 (transcriptional regulation protein)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYAR007C2.0004062814618821e-57RFA1 SGDID:S000000065, Chr I f
rom 158619-156754, Genome...
T. thermophilaTTHERM_001068901.9998323414791308e-36hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5713.0.g13(coding)
ATGCTTACCGCTCATTAAAACAACTCTTCCCTCTAAAATAGTCCAGACGCTAAAAAGTCA
AAGATCGACGATTTGGTCAACTAAGACTTTGATTTTTCAGTGAAATCCTTGACTGAGAAC
GGAATTAGAGATATCTGCGATAAGAATAAGCAGGCTGAAGTGAAAACTTAGACTTTTATC
ATTCAAGCCATTGAGACTAAGGTTTTCACAGAGGATGACAAAAAGAAAAATGTCAAGTAG
AGAATTCATCTCTCTGATGGTACTTCAACTGTTATAGCTATGATCACAGAGAAAATGGAC
AAATAAATGAACAGTATTGCTATTCCAAGATACTCAATCTTGAAAATGACAGGCAATATG
CTTCAGACTTAAATCAACGAGAGAAAAGTATTGGTTTTCAAAGAAATTCCAGAAATTTTG
TACACTGGTTTGACAAAAGCTGTTGGCAAACCAAGAGAATACGAAAAAAACATGCAAGAC
ACCGATTACTTCCAAAATATTGACATTGATTTAACTATCAATGTCAACGATACCATTGAG
TACCAAAAGATTCATGCTAAGGACAGTAGTGCTGCTAAGTCAACTGTCTCAACAATCCCA
TCAAACAGTAATTAAAATTCTGCTCAGAAAGTAGAATCCCCCATTGTTGATAAAGCTGAT
ATCTTTAACAAGAGAGCTAAGGAAATTCTTAACATGAGTGGTGATATACAATATACCCCA
ATCAAGTCACTCAACGCTTTCCTCTTTGACTGGAAGATTAAGGCCAGAGTTACCAAGAAG
TGCGATTTAAAGACATGGAAAAATGCCAAAAGTGAAGGTCATGTTATGAACGTTGAACTC
ATTGATAATCTTGGTACCTTGATTCTAGCAACTTTCTACAACGATGCTGCCCTCAAGTAT
AACGAAATGCTTCAAGAAAATCACGTCTACTTGATGTCAAATGGATCAGTAAAGATTGCC
AATAAAAAATTCACCAGTATCAAGAACGATTATTGCATCGTCTTTGATAAGAGCTCAGAT
ATCAAAGAAGTAGAAGATGATAGCAACATTCAACAATAGGGCTTCAACTTTGTTACTATT
GATGAAATTAATGACTTTGAACAAAGCAGAACCGTTGACACTGTGGGAGTTATTACTCAA
GTTGGATAATTAAGCTCTTTCTAACCTAAGAACGGAGGAGCCGCAAAAGATAAAAGATCA
CTTTAAATCGCTGACGAGAGTGGATTAGCTATTTCAATGACTCTTTGGGGTCAAAATGCT
AGTAAACTAGAATTCAAAGAGGGTTCAGTATTAGCCATTAGAGGAGCAAAGGTTTCGGAC
TATGGTGGAAAAACTTTGAACTCTGGTCACGAGCACAGTCAAATCTTTATAGATGTCGAC
CACAAAAGAACCAGAGAGTTGAAACAATGGAATGCAAATAGAAACCAAGATGGTCTAAAC
TCAGTCAGTACCATTGGAGGTGCCCAAGGTAATTAACAATCTGAGAAGCTAGATAACTTC
AGGTTAATTTCCGAAGTTGTAAAGAATGTTTCTGAGGAGGGTGCTAGTCATCAACCAACC
TATAACTCTATGTACGCTCAACCAAAAGCTAAGTTTTTCAAAATAAGCGGCTTTGTGAGT
CATGCTAGAAGTGACGATAAATATTATTATTTGAGTTGCCCAGACTGCAGAAGGAAAGTA
GTCGATGAGCTTGAAGGCTTTAGATGCGAGAATTGCAATAAATCATTCAGCAGATCTTTC
CCAACTTACATTATGACTGTAAAGTTCCAAGATGCCACTGGAGATATGTACATTCAATTT
GCCAGAGAATTAGGCGATCAAATTATGGGCATGACAGCTGAAGAATTTAAAGACGCTAAA
GAATAATTAGAGAACCCAGAAGAAATGAAACTTTTCCTCTCCCAATAAATTCTCTACAAA
GCTCATTCAGTTGTAATCAAGGCATAAAACGATCAATATAGAAGCAGCACAATGATGGAA
GGAGACCAAAGAATTAAGTACACCGCAATTAAAGTTGCCCCAATTAGCTTCAAAGAAGAG
AACAATATGCTATTAAAGAGATTATCTATGTACGAAAACAGAGACAACAAAATGCAAACA
TATTGA


>Contig5713.0.g13(protein)
MLTAHQNNSSLQNSPDAKKSKIDDLVNQDFDFSVKSLTENGIRDICDKNKQAEVKTQTFI
IQAIETKVFTEDDKKKNVKQRIHLSDGTSTVIAMITEKMDKQMNSIAIPRYSILKMTGNM
LQTQINERKVLVFKEIPEILYTGLTKAVGKPREYEKNMQDTDYFQNIDIDLTINVNDTIE
YQKIHAKDSSAAKSTVSTIPSNSNQNSAQKVESPIVDKADIFNKRAKEILNMSGDIQYTP
IKSLNAFLFDWKIKARVTKKCDLKTWKNAKSEGHVMNVELIDNLGTLILATFYNDAALKY
NEMLQENHVYLMSNGSVKIANKKFTSIKNDYCIVFDKSSDIKEVEDDSNIQQQGFNFVTI
DEINDFEQSRTVDTVGVITQVGQLSSFQPKNGGAAKDKRSLQIADESGLAISMTLWGQNA
SKLEFKEGSVLAIRGAKVSDYGGKTLNSGHEHSQIFIDVDHKRTRELKQWNANRNQDGLN
SVSTIGGAQGNQQSEKLDNFRLISEVVKNVSEEGASHQPTYNSMYAQPKAKFFKISGFVS
HARSDDKYYYLSCPDCRRKVVDELEGFRCENCNKSFSRSFPTYIMTVKFQDATGDMYIQF
ARELGDQIMGMTAEEFKDAKEQLENPEEMKLFLSQQILYKAHSVVIKAQNDQYRSSTMME
GDQRIKYTAIKVAPISFKEENNMLLKRLSMYENRDNKMQTY