Identifiers and Description

Gene Model Identifier

Contig6434.0.g98

Standard Name

RP041

Aliases

Contig6434_0_g98

Description

DNA-dependent RNA polymerase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011195409.997093137033517e-262DNA-dependent RNA polymerase f
amily protein
SGDYFL036W2.999370583638828e-134RPO41 SGDID:S000001858, Chr VI
from 58782-62837, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6434.0.g98(coding)
ATGATTATTAGATAGGCTTACAAATAGCTAGCAACCACTCGCTCTCATTTAAATGCTCTC
TCCCGCTCTTCTTAGCTTGCTAATTTGCCTTTAGTCAACCAAGCCAATAATAGCATGAGT
TTGAGTTAGCAAATAAGCAATCAATCTCTGTTCCAATAATAACAATACAGTTTTAGTGCA
GCATCAGCTGGTAGTGAGATTCTAAAGAAAGTGAGAAAGCTCTCAAAGAAAGAATAAGAA
GAAAGTCTTAAAATTTAAGAGGAACCTAAAAGATAACATATTTTCAAGGAAATTCCTAAT
ATAGAAGCGGACATTGAAGAAATGAGGGCTGATGGGCTTACAAATATAAATATATCACGT
AAAAAAGAGTAGATTAGGGAGACTAAGATAATATAAGAATAGCAAAAAGAGAAAGAAATG
GAAGAGTAGGAGCATCAATTCGACTTCTATAAGGGAAAATCAGATAAGGCTAAGCAAGAT
AGAAATTATCAAAGAATGATTATGGACACTTATGATTGCGTGAAATTCTTAAACAAGCTG
CCTTTAGGTGTTTTGGAGGAAAGTCTAAGTGTTTTTAGAAGCCATTTGTTTAATATGAGT
GATAGGAAAATGATTGCAGTTAGAATTTTTGAAATTTTGTAAAAAGAATACTAAATTGAA
TAGCAGTAAAAGCTGTCTGGGGATGGTGAAATACTTGCCAATTCCTAAGATAAAAAAGTC
GAAGACTTTATTGGACACAATGGAGATGAAAGCCTTATGATTGTTGCTAATTAAGTTTAC
GCTTCAATGCAAACAATTCTAGAATTCATGGACAAAGGTATTAAAGGGCTTCTAAGTGGA
GATATGTCAGTATATATCATTCAATAGATCCAGACTAGTATCGAGAAATATATGAAGACA
TTTAATGATATTTCTGCAGAGATTGACTTGATATTACAAAAACAAATAAGCGTGGAGCAG
TTTCTGTAGGAAAATTTCTAGGTTGGAATGAATGGTCAGAATTAGGTAAACAACCCTAAC
TATGAATCATTAGAAAATTTCGAATCTTATATGCTTATGTTAGACTAGAAAGACTGGAAG
AAGAGCATTTAGGTTTAGGATACAATCAGTTACTAGTCACCTGGAAGTTTGATCAATCCA
GATATGCTGAAAAATTCAAAAGTTCTCTCTTCACCAAACTAAATATCTTAAATACATTTT
GAAAATCCTGAGAACATGAAAATTTTCATGCAAAATAGAGTAAAATAAGTTCAAGATACT
TAATAAGAGAGATTAGAGGCATTAAAAAAGGAAATTAACTTCCTAATTAACAAACTCTAT
TAAGAAGTGTGCAAGACTGCTTTCAACTTAGATAAATACAGACTACCAGTTCACGGAGTA
CAATATCCTTAATTTGAAAATCCTATGAACCTGTTTCAGAGACAGCTAAAAATTGAGGAG
CTATCTTTCGAGCTCTCATAAAACAAATACAAAAATCAGCTGGACTCTTTGATTAAAATT
GGAAGAGGTGATTAACTTGCTGTTTCACATAGATACATTCTTTCTTGGATGAGACTACTA
GAAACTTCAATTGCTGAGTAACAGAAAATCTTTATCAAAAGAGGCAACTTAGACCCTAAA
AACTCAAAGATTGGCTACTACTTAATTCAAATGCCAAGTGAGAAGATAGCTTCTTTATGT
GTTCTACATTTAATGAAGCATCTTTTTAAGCAGTTCATTCATGATATACGATAATTTGAT
GATGAGGATTTCACTGAGAAAATTGAATAGAATCATGAAATTAAAATACCAGCCATCTAA
TTATTTGATGAGCTCGGAAAGCTCTTCGAGAAAGAACTTAAAAATACCCTCATGACTGGA
AAGAAATCTCAAAAAAAACCTGATGATGAAGAGGATATTCTTCAAGAAGACATGGAACAG
GAAATTGGAGACGAGAGAAACGCTTTAAACAAAAAGATTGCCAAGCACATGCTAATGGAA
GATAATTTCATTGGTCATCTTCCTAGAGATGTATAATTGAAAATTGGCGCATTTTTGACA
AATTTGATGTGCAAAAATTTAAAGTATAAAATTGGAAACAAAAGTTATCTATTGTTAAAG
CCCTAAGTTTTAAAGCAGCAGGAGAAGAAGTACTTGGGTTATATCATCTTTAACAGGTCT
TTTATTGAGACCTTTGTTGGAGAATTAGATAAGATTCATGATTTGAGTCTCTAACTAGAG
CGTAGTTTGCCTATGATTTATTAACCTGCTCCTTGGAAGAATTTTACTTTTGGAGGCTAT
TACCTGAAATAAACTAAAATGGCTAAAGTCATACCAAACTTTAAAGAAGCTTAGAAGTAT
TTGTAGAGAGTTGATTTAACAAACATGTGCTAAGTTTTAGACATTTTAGGATCAGTTAAA
TGGAGAATTAACAGAAGAATTTTGGAAATTATCGAATATGTCTGGTCGATTGGAGGTGGT
CTAGGAGAAGTACCTAAAAGGTTTAATGATAGGTAAATCACTCCAGAGATGATTAAAGAG
ACTAACTTCAGAGAAAAGCTAAAGCTGCTTAAAGAACATCAAAAGAATAGAGAAACTCAT
GCTTTAAGATGTGAATTTTTGTTGAGGCTTTCTATTGCTTAAAGTTTCAAGCATGTTAAC
TAAATATATTTTCCACATAATATGGATTTCAGAGGAAGAGTTTATCCTATTCCTCCTCAT
CTAAATCATATGGGAGCTGACGTTAATAGAGGACTTTTATAATTTGCTGAGGGTTAACCT
TTAGGAAAGGATGGTCTTTTCTGGCTTAAGGTACATGTATCTAATAAGATTGGTAAAGAT
AAATTACCCATCGTTGATAGAGCTGCTTATGCAGAATCTGAGATGGATATGATCCATAGA
TGTGCTGATGATCCCAAAAATAACCTAGATTGGCTCTAAAGTGACAACCCATGGCAAACT
CTTTCTGCTATGATTGAACTAAGTTAGGCTGTTAGGTGTAAGAATCCAGAAGAATATATA
AGTTATCAGCATGTTCACGTCGACGGTAGTTGTAATGGTATGCAACATTATGCTGCTCTC
GGAAGAGACGATAGAGGTGCCAGATAAGTCAACTTAGCAGATTCAGAAAGACCAGGTGAT
GTTTATACTGCAATCTTGAGACTTGTTATCGAGCATATCGAGAATGAATAAGACCAAGCA
TTACACGAAGTTGCAGAAGGGTTAAAAGGAAATGTAAACAGAAAGACCATCAAGCAAACA
GTCATGACATCTGTCTATGGTGTGACCTTCATCGGTGCTAGAAAGTAAATTTAGAGACAG
CTCAAAGATCGTAAACTCTATGAGACAAACGGAGAGCTATACAAAGCCTCTCAATATCTC
GCAAAAGTGACTATAAAATGTATTGGAGACCTTTTCAGAGATGCCAACAATATCAAAGAA
TGGTTCTCAAAATGTGCGAAAGTTGTCGCTTCAACTAATGAGCCAGTTAGATGGATAACT
CCACTTGGTTTACCTTGTGTTCAACCATATAAGAGTGTATCAAACTAAAGTGTAATAAAG
ACTATTCTACAGTAAATTACTGTGGCTGATAGTTTAGATGATCAACCAGTTAATAAATAA
AAGCAAAATTCTGCGTTCCCACCAAACTTTGTGCATTCCCTTGATTCAACTCATATGATG
TACACAGCTCTAGAATGCAAGAGAAAAGGTATAGTATTTGCTGCAGTGCATGATTCTTTC
TGGGCACATCCAAGCAACATTACAGAAATGAACGCAACTCTACGTCAGCAATTCGTTACT
CTTCACGGTAGTTCTGTCTTAGAAAATCTGTATGAAAACTTCACTAGCAGATATCCAAAT
GAAAAGTTCCCTGAAATTCCAAAGAGAGGTTCTTTCGATCTAAATGAAGTCAGGAAATCT
ACTTATTTCTTCAGTTGA


>Contig6434.0.g98(protein)
MIIRQAYKQLATTRSHLNALSRSSQLANLPLVNQANNSMSLSQQISNQSLFQQQQYSFSA
ASAGSEILKKVRKLSKKEQEESLKIQEEPKRQHIFKEIPNIEADIEEMRADGLTNINISR
KKEQIRETKIIQEQQKEKEMEEQEHQFDFYKGKSDKAKQDRNYQRMIMDTYDCVKFLNKL
PLGVLEESLSVFRSHLFNMSDRKMIAVRIFEILQKEYQIEQQQKLSGDGEILANSQDKKV
EDFIGHNGDESLMIVANQVYASMQTILEFMDKGIKGLLSGDMSVYIIQQIQTSIEKYMKT
FNDISAEIDLILQKQISVEQFLQENFQVGMNGQNQVNNPNYESLENFESYMLMLDQKDWK
KSIQVQDTISYQSPGSLINPDMLKNSKVLSSPNQISQIHFENPENMKIFMQNRVKQVQDT
QQERLEALKKEINFLINKLYQEVCKTAFNLDKYRLPVHGVQYPQFENPMNLFQRQLKIEE
LSFELSQNKYKNQLDSLIKIGRGDQLAVSHRYILSWMRLLETSIAEQQKIFIKRGNLDPK
NSKIGYYLIQMPSEKIASLCVLHLMKHLFKQFIHDIRQFDDEDFTEKIEQNHEIKIPAIQ
LFDELGKLFEKELKNTLMTGKKSQKKPDDEEDILQEDMEQEIGDERNALNKKIAKHMLME
DNFIGHLPRDVQLKIGAFLTNLMCKNLKYKIGNKSYLLLKPQVLKQQEKKYLGYIIFNRS
FIETFVGELDKIHDLSLQLERSLPMIYQPAPWKNFTFGGYYLKQTKMAKVIPNFKEAQKY
LQRVDLTNMCQVLDILGSVKWRINRRILEIIEYVWSIGGGLGEVPKRFNDRQITPEMIKE
TNFREKLKLLKEHQKNRETHALRCEFLLRLSIAQSFKHVNQIYFPHNMDFRGRVYPIPPH
LNHMGADVNRGLLQFAEGQPLGKDGLFWLKVHVSNKIGKDKLPIVDRAAYAESEMDMIHR
CADDPKNNLDWLQSDNPWQTLSAMIELSQAVRCKNPEEYISYQHVHVDGSCNGMQHYAAL
GRDDRGARQVNLADSERPGDVYTAILRLVIEHIENEQDQALHEVAEGLKGNVNRKTIKQT
VMTSVYGVTFIGARKQIQRQLKDRKLYETNGELYKASQYLAKVTIKCIGDLFRDANNIKE
WFSKCAKVVASTNEPVRWITPLGLPCVQPYKSVSNQSVIKTILQQITVADSLDDQPVNKQ
KQNSAFPPNFVHSLDSTHMMYTALECKRKGIVFAAVHDSFWAHPSNITEMNATLRQQFVT
LHGSSVLENLYENFTSRYPNEKFPEIPKRGSFDLNEVRKSTYFFS