Identifiers and Description

Gene Model Identifier

Contig22187.0.g96

Standard Name

ROX1

Aliases

Contig22187_0_g96

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002160400.0000029996948234116693HMG box family protein
SGDYDR174W0.000009999254677478949HMO1 SGDID:S000002581, Chr IV
from 812110-812850, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22187.0.g96(coding)
ATGCCACCAAAGAAGGACGTTGCCACCAAGGGAGTTAAGGGTAAGGCTAAGGCCGTTGCC
AAGGAAGAGAAGAAACAGCAAAAAGTCGCCAAGACTCAACCAAAGGGTGCTGCCAAGCCA
GTTGAGAAGCTAACCAAGAAGGAGAAGCGTGCCAAAAAGCCAGTTGGCGCTCCAAAGAAG
CCAATGAGCGCATTTTTCTGCTATCAATAAGCCAGAAGAGAACCTCTTAAGAATGAGGCT
CCATAACTTAATCACAGAGATATTGTGAAAAGAATGAGTGAGGAGTGGAAAGCTATGAAC
GACGCTCAGAAGCTACAGTTCGTCAATTAGTCAAACGATGCTAGAGAGTTATACAAGGTT
AAAATGACTGATTTCAAGGCTAAATAAGCAAAGATTGCTGCTACTGCAGGTGCCTCCACT
GATAACGTTGTGGGAAAGAAGAGACCAGCTTCAGCTGCCCCAGAGAAGGGATCTAAGAGC
AAAACTGGCACTCCAGCAAAGGGAGGAAAGGTTGCCGACGCCAAGAAGGGTGGTAAAGCT
GGAAAGGGATCAGTTAGAGTTGCTGCTAAACCAGCTGCTAAAAAGACTGTCGCCCCAGTT
GAACATCACGTCAATGCAGAAGAAGGCCAAAAGAAGAAGACTCCAATGAGAGCTCAAGTC
GTAGCTGAAGATGTTGCTCATCAACAAATAGTACCACCAGTTGGACATCACGATCAGAAT
GGAAACGTTCATCACCACCAAGTTGCTCCAGTCCACGTGCATCACGAAGTGTAATAACAA
TAATTAGTTCATCATGAAGTCCCTGTTCAACACCACGTAGAGCACCACCAAGTTGATGAA
CCAGTTGAAGACAATGACGATGATCAACTTGACATTCAAGATGACGGTGAAGATGAAATC
GAAGAGCAAGGCGGTGATGACCAAGAAGAGCAATGA


>Contig22187.0.g96(protein)
MPPKKDVATKGVKGKAKAVAKEEKKQQKVAKTQPKGAAKPVEKLTKKEKRAKKPVGAPKK
PMSAFFCYQQARREPLKNEAPQLNHRDIVKRMSEEWKAMNDAQKLQFVNQSNDARELYKV
KMTDFKAKQAKIAATAGASTDNVVGKKRPASAAPEKGSKSKTGTPAKGGKVADAKKGGKA
GKGSVRVAAKPAAKKTVAPVEHHVNAEEGQKKKTPMRAQVVAEDVAHQQIVPPVGHHDQN
GNVHHHQVAPVHVHHEVQQQQLVHHEVPVQHHVEHHQVDEPVEDNDDDQLDIQDDGEDEI
EEQGGDDQEEQ