Identifiers and Description

Gene Model Identifier

Contig6080.0.g99

Standard Name

ROK1b

Aliases

Contig6080_0_g99

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007008705.998752501907352e-124Type III restriction enzyme, r
es subunit fami...
SGDYGL171W1.9998944264638884e-101ROK1 SGDID:S000003139, Chr VII
from 182390-184084, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6080.0.g99(coding)
ATGCTTAATTTATAGTAAAACAAGAAGCAATAAAATCAGAAAGCCAAAAAAGACAAGCTT
AAGTAATAACAATAGTAATTAGCAAATACCAATGAAATTATTGCTACATAAGAAATTTAA
GAAACAATTGACCCCAGAGATTACTTGAATTACGAATCAGACAAGGAACTCCCACAGATC
AAAGCTCAGCTTAAAGAGTTAAAGTAGCAATTAAAAACTACTCAGAAATAGAAAATACTG
GATAAAATTTAGGAAGAATATAAACACTTAATGAATAAAAAGAGGGAGGTGGAGAATGCA
CTCAGAAAGAAATATAGAATCAAAGTGGAGGGCGATAATGTACCAGAGTTGTTAGATAGT
TTCAGTAAACTCAAGGAAAAATGTGGGCTTAGTGAAAGCTTTATGCATAAACTCAAGGAA
AACGGGTTCAAAAAGCCCACCCCTGTGTAGATGCAAGCAATTCCAGTATTATTCAATAGA
CGTTCAGCAATAGTTTTGGCAGAGACTGGAAGTGGAAAATCGCTTGCTTTTATTGCACCT
ATGCTACATTTATTGAAAAATGGAGATGGTCTCAAGGCTGTTGTAGTCTCACCCACTCGT
GAACTCACAATCTAGTTGTACAAAGAATTCTTAATGTTCAGTTAGATTGGGAGTCACAGT
ACATCTCCTAGAGTGAGATTCCTTAGAAAAAGTCTCTTCCCAACAGATCAAGAGTCTTTT
AATTAACTGACTTAATCATGCGAGATTTTGATATCCACACCATTGAAATTGGCTGAACTT
TGCCAACAATACAAATTAAATAATTTGGAATTTCTCGTCGTAGACGAAGCTGATAAGATG
TTTGAATTAGGATTCTTGGAGCAAGTAGATTAAATTCTGGAGTAATAAAATGAGCAATAT
AAAATCTGCAAGTTTTTATTTTCTGCCACCATGCAACCTGGTATTGAAGAGTTAGTTAGG
ACTATAATGGAAGACCCTATAAAGATCCAAATGGGCATTAAAAACGCTTCAAACTAGCTG
ATCGACCAGTAGATTTAATACGTGGGAGATGAGCAGGGCAAATTGCACACTTTGAGAGAA
TTACTGGCTGATGGCTTCGAACCTCCCATGCTTATATTTGTATAGTCCAAGCACAGAGCC
AAGGAACTTTATCATGAATTGATCTATGATGGATTGAATGTAAATGTTATACATGCTGAT
AAAAAGAAGCACGAAAGAGATGAAATAATAAAGCAATTCCGTCTGGGCAAAATCTGGGTG
TTGATAGCCACAGATCTGATGTCTCGTGGTATAGATTTCAAGGGTGTAAATACAGTAGTA
AACTATGATTTCCCACAGAGCATAGTCAGCTACATTCACAGAATTGGAAGAACAGGAAGA
GCTGGAAAGGCAGGCAAAGCAATTACTTATTTCACAGATGATGATGCTGAATTCCTCAGA
AATCTCGCCAATTTATTAAAGAAATCTGGACTTGATGTGCCAGATTGGATGTTGACCATG
AAGCCAGCCACCAGCAAAAGATGGAAGGAAATTGAAAAGAAGCCAGTGCACAGACGCACT
ATTTCAACAGACATTGAAAAGAACACTAAACAACGCTTCCAGAAGTAGATCCTCAAGGAA
GGAAAGAAACTGGCCAAATTAGCTGAGAAATTCCCTCAAAACATCAATCCAGTAGATGAA
GATGGGGATGAAGATAATCTAACCCAGGGTTAAAAAGGCGTAAAAGGAGGCAATCAGATG
GATGATGAGGATGATGGAGAGGAAGTATGGGATGAAGATGAGAAACTGCAATCTGGTGAG
GAATTTGCCAGTGACGATGAGGATATCAACTCTGATGAATATTGA


>Contig6080.0.g99(protein)
MLNLQQNKKQQNQKAKKDKLKQQQQQLANTNEIIATQEIQETIDPRDYLNYESDKELPQI
KAQLKELKQQLKTTQKQKILDKIQEEYKHLMNKKREVENALRKKYRIKVEGDNVPELLDS
FSKLKEKCGLSESFMHKLKENGFKKPTPVQMQAIPVLFNRRSAIVLAETGSGKSLAFIAP
MLHLLKNGDGLKAVVVSPTRELTIQLYKEFLMFSQIGSHSTSPRVRFLRKSLFPTDQESF
NQLTQSCEILISTPLKLAELCQQYKLNNLEFLVVDEADKMFELGFLEQVDQILEQQNEQY
KICKFLFSATMQPGIEELVRTIMEDPIKIQMGIKNASNQLIDQQIQYVGDEQGKLHTLRE
LLADGFEPPMLIFVQSKHRAKELYHELIYDGLNVNVIHADKKKHERDEIIKQFRLGKIWV
LIATDLMSRGIDFKGVNTVVNYDFPQSIVSYIHRIGRTGRAGKAGKAITYFTDDDAEFLR
NLANLLKKSGLDVPDWMLTMKPATSKRWKEIEKKPVHRRTISTDIEKNTKQRFQKQILKE
GKKLAKLAEKFPQNINPVDEDGDEDNLTQGQKGVKGGNQMDDEDDGEEVWDEDEKLQSGE
EFASDDEDINSDEY