Identifiers and Description

Gene Model Identifier

Contig17410.0.g31

Standard Name

RNPS1

Aliases

Contig17410_0_g31

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam09726 ) Transmembrane protein

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17410.0.g31(coding)
ATGTAAGATGATAATAAACTATCAAGTATTGAAAAATTGAATATAAGCTCGGATAACATT
TAATAAGATAATATTTTCAAAGCTAAACCTAATTTTCCTGCAGAATAAGAACCTAAAATA
ATTGTTAGAAATATCTCTAGAAATGTTCATGTGGATCACCTGATAGAAATGTTTGAGACT
TACACTCAGATTAAAACAATCGAAGTACCCATAAAAATGCTTAGAACCCCTGTGTTCGAG
TCCATGATGCATCAAGAAAGCTATTCCAATAATTTTTATGAATAAAAGAAAATTAAAATT
TCAAATTTTATGTAACAAGACTATGCCGAGGTAGAATTCTAAAATCTTTAAGATGCAGAA
TAAGCATTTATGAGATTTAATGGGGCTTAATTAGATGGTTAAGTACTAAAATTAAAGTTT
TACCCTATAAGAATCGATAGAGTGATGCTTGAAGAAGAGTTTAAGTAGAAGTATAACATA
ACTGAGGAGCAATTGAAGCAACAAGAATTATTAAAAGAACAAAATCATAAGGAAATAGCT
AGAGAGAGTAGAATTAAAAAAACAGATTCAAGGCAGAGAAGTCGGAGCAGGGGAAGAGAT
AGGAAAAGATCACATAGTAGGGATTATAAACATAGATCCCCTGCTAGAAATGGCAGATAT
AGAAGAAATTCACCAGCTAGACGTCCTTAAAGAGGCAAGTATTAAAGCTATAGAGGAGGT
ACTAGGAGAGATAGGAGCTACTCAAGAAATCGGGATAGAAGGGGAAGATACAACAATCAC
AGAGGTGGTAGGAGAAGATCAAGTTCAAGATCTTCATCTTCAAGCAGCAGGAGTAGAAGT
TCTTCAAGGAGTAGTTCAAGATCATATTCATCTTCCTCATCTTATTCTAAAAGGAGTTCC
CATAGCAAATCATACTCATCCTCATCATCCCGATCAAGATCAGCAAGCAAACACTCTAGA
AAAAGAGAATTAAGACCCTCTTCTTAAGAATCTAAATCTAGATAGAAATCTAAGAGTAAG
GAATGA


>Contig17410.0.g31(protein)
MQDDNKLSSIEKLNISSDNIQQDNIFKAKPNFPAEQEPKIIVRNISRNVHVDHLIEMFET
YTQIKTIEVPIKMLRTPVFESMMHQESYSNNFYEQKKIKISNFMQQDYAEVEFQNLQDAE
QAFMRFNGAQLDGQVLKLKFYPIRIDRVMLEEEFKQKYNITEEQLKQQELLKEQNHKEIA
RESRIKKTDSRQRSRSRGRDRKRSHSRDYKHRSPARNGRYRRNSPARRPQRGKYQSYRGG
TRRDRSYSRNRDRRGRYNNHRGGRRRSSSRSSSSSSRSRSSSRSSSRSYSSSSSYSKRSS
HSKSYSSSSSRSRSASKHSRKRELRPSSQESKSRQKSKSKE