Identifiers and Description

Gene Model Identifier

Contig6494.0.g44

Standard Name

RNPC3

Aliases

Contig6494_0_g44

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam06758 ) Repeat of unknown function (DUF1220)
  • ( pfam05859 ) Mis12 protein
  • ( pfam12830 ) Sister chromatid cohesion C-terminus

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6494.0.g44(coding)
ATGAACTTATTAGCTCTAGACCCACCTTTTGAAGAAGATTTTCTCTCTACTTCTACTTTC
CTATCTAAGCCTAAGCTTATTGATGAAAGGATATCTTTTGTAAAAAATGGAGGACCCAAA
CTTTAAAAGTTAATTAACTCAATTACTGTTAATCATAAATAGGGTTAAACTATAGTATAA
GATGAATGTGAGATCATTGCTGAGTTGTAGTAGATACTTTCCACATCATCTGCTCTTGTT
GATGACTTATATTAAGAAGTATAGCATCTGCAAGTTAAGTTAGATAATATTTTAGAGGGT
GACTTGAAAATGAATTAATAAGCTTTAGATAAAGAATAGCTTGACAATTTGAACATAAGG
CCTATTTAAGATGGAACCAAGCCGATTTTAGATTCTAAAAATAAAGTGAACTTTGATTTT
GATACAGCTTCCAAAATGAGTTAACAAGATACAATTATGAATACGGATTAATAGGTCAAA
ACTCACAATATATTTTAGCAGAGCTTAGATAATATTCAAACATCAGAAATGATATAGAAT
GAAAAACCATAGTCATACAATTAATATATTAAGCATGACTTGAAAGAGTATGAAGATTTA
GATGATTATTTGAGAGAACTGCAATCAGAGCTTCAAGATAACAATAAAGTTAAAGAAGAG
CTTGAAGAAGTGGATTATGATATATGGTTTGCTAAAAAGTCTAAGAACTATGATGGCCGC
ACCAACTTCCAACAAGCTAAGAAGGATCAATAAGTTACTAACAGTTTGTACATTAAGAAC
ATTGACAAGAAAGCAAAAAGAAAAGACTTCATAAATTTGCTATTGCCTTTCTTTGAAGAT
AGCCAAACGAAACTAGATGTAGAAGTTGAAGTCATAATAATGTAGAAGGGGAAAATGAGA
GGTCAAGGGTTCATGAATTTCAAGGAAATCAGCAAGACAGTCGAAATCTATGATGCGCTC
TAGGGCATAGTCATTGGCTAAAAACCTATATAAATGGAATTTAGTGCAAGCGGCAATAAT
AAGAGAGTTAAGAAGGATTCAAATTGA


>Contig6494.0.g44(protein)
MNLLALDPPFEEDFLSTSTFLSKPKLIDERISFVKNGGPKLQKLINSITVNHKQGQTIVQ
DECEIIAELQQILSTSSALVDDLYQEVQHLQVKLDNILEGDLKMNQQALDKEQLDNLNIR
PIQDGTKPILDSKNKVNFDFDTASKMSQQDTIMNTDQQVKTHNIFQQSLDNIQTSEMIQN
EKPQSYNQYIKHDLKEYEDLDDYLRELQSELQDNNKVKEELEEVDYDIWFAKKSKNYDGR
TNFQQAKKDQQVTNSLYIKNIDKKAKRKDFINLLLPFFEDSQTKLDVEVEVIIMQKGKMR
GQGFMNFKEISKTVEIYDALQGIVIGQKPIQMEFSASGNNKRVKKDSN