Identifiers and Description

Gene Model Identifier

Contig18517.0.g33

Standard Name

RNMT

Aliases

Contig18517_0_g33

Description

mRNA capping enzyme

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004312501.0000633497921574e-36mRNA capping enzyme, large sub
unit family pro...
SGDYBR236C9.99723014177113e-33ABD1 SGDID:S000000440, Chr II
from 691693-690383, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18517.0.g33(coding)
ATGCAAGATAACTAACAGACAAGAGAATTCTCTGAGATTATCTTTATGAGAAAATTCAAT
AACTTTATTAAAGCCATTCTCATTGATATGTACAATGAAAAACTTCAAAAGAATTGCAGA
CAGTATAAACCTAGTATATTTGACCTTTGCTCTGGAAAGGGAGGAGACTTAATGAAATGG
TTGTATAAGAAGCCCTCGCATTATGTGGCGTTAGAATATTAAGAATAGCTCTCCTTGATT
GCGAAAGAAAGACTTTTAGCGAAGAGTAATGTTAAATTTCCAAGTATCTTTGTAGTTGCT
GATGCTGGGGATCCCACTATGACAATTGATAAAGTTTTCTAAGATGACAGGCTGAGGGAC
ATCAAAACTCCAATAGTCTTTGACATTGTGAGTTGCTAATTCGCTATGCATTACATGTTC
GAAAGTGAAGTCAAGCTTAGAGCATTTCTGCATAATGTATCTTGCAGATTAGAGACTGGT
GGATTCTTCATTGGGACAACTATAGATGCAGATAGAGTAGTTTCTATGATAAGAGAAAAA
GGAGGAAAAAACCTGACTGTTGGCAACAAGTTCTATCAAATCAGATTTGGCCAGGCCTCC
TTCCCAAAAGATTAAGGACCTTTCGGTTTGAAATACTATTTCTATCTCAAGGATGCTATC
GGTAGAGAGCGACTTCTAGAAGATAAAAAGATTCATGTACCAGAATATTTAGTCATCTTT
GAATATCTTGAGAAGCTTGCTTTGGAATATAACTTGAAACTTATTGAGAGAAAGAATTTT
CATGAGTTTTACTAGGAATCCATACAAATACCAAAGAACTAATAGTTATTCGATAAAATG
GTAGCTAAGGAATCTGGACAAAAATTAACTTAAGATGAGGTGGACATGCAATTTGAAATC
AGTGGCTTATATTAGGTTTTTGCCTTTGAAAAGATAGGCAATTAGAGAAGAACAACTAAT
AGATTCTTTGGGAATATGAAGCTTTATAGAGAAATCAATATGAGAGCATTCAGATGA


>Contig18517.0.g33(protein)
MQDNQQTREFSEIIFMRKFNNFIKAILIDMYNEKLQKNCRQYKPSIFDLCSGKGGDLMKW
LYKKPSHYVALEYQEQLSLIAKERLLAKSNVKFPSIFVVADAGDPTMTIDKVFQDDRLRD
IKTPIVFDIVSCQFAMHYMFESEVKLRAFLHNVSCRLETGGFFIGTTIDADRVVSMIREK
GGKNLTVGNKFYQIRFGQASFPKDQGPFGLKYYFYLKDAIGRERLLEDKKIHVPEYLVIF
EYLEKLALEYNLKLIERKNFHEFYQESIQIPKNQQLFDKMVAKESGQKLTQDEVDMQFEI
SGLYQVFAFEKIGNQRRTTNRFFGNMKLYREINMRAFR