Identifiers and Description

Gene Model Identifier

Contig14329.0.g31

Standard Name

RNH2

Aliases

Contig14329_0_g31

Description

Ribonuclease HII

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001422904.001287313050914e-66ribonuclease HII family protei
n
SGDYNL072W9.9981864321491e-40RNH201 SGDID:S000005016, Chr X
IV from 490317-491240, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14329.0.g31(coding)
ATGAAAAGTAGAAAATCACCAGCTAAGCCATCTAGCACTACTCCATTAAGCACAGCCAAT
CAATAACCCCAAGAAGTTGTTAAAGATAGTTAAAATTAGTAGAATGCTGCCCCTCCCACA
AAGAAAAATCACGGTAGATAGGCTAAGCATGAAGAAATTAAGATCAGACATCATACTACT
ATTACTGCAACATCATAAAAGCAGATCACAGAGACTGGTGTCAATGAATTGAGGGAGTAT
GCTTTTAAAGATGAACCATGTGAAATCGGTATAGATGAGGCAGGGAGAGGACCTGTCTTG
GGACCAATGGTCTATGGATGTACATTTTGGCCCATTTCATAACGAGATGAATTTAAGAAG
TAGTATAAGTTCACAGATTCAAAGCAGCTTAACGAGCAACAGAGAGAAGAAATGTTTGAA
CAAATCAAAAGTTGCGAGTTCTCTCGCTTGGGATACTTTACAGCAGTATTGCATGCAGAC
TACCTCTCGAATTTGATGTTGGCAGAGATGAAAAGCGGAGGCAAAAATCTCAACACTATA
TCACATGACACAGCTATTGATTTGATCAAGAAAGTCAAGGCATTGGGTGTTAATGTCAAG
AGAGTTGTGCTAGACACTGTTGGTTAGCCTCATTCCTACAAACAACTTTTGCATAACCGA
TTGAAAGATGATGAACTTGAAATCATAGTGGAATCTAAGGCTGATTTGAATCACCCTGTT
GTCTCCGCAGCCTCAATTTGTGCAAAAGTAACTAGAGATTAAGTGCTAGCTGACTGGCAA
TTCCCTGAAGATAAGAAAATCGATACTGACTATGGTTGTGGGTACCCCGGAGACCCCAAG
GCTAAGGAGTGGCTCAAGAGAAATCTAGACCCTGTATTTGGATTCCCTACACTTGTGAGA
TTCAGCTGGAAAACTTGCTCCACTATTCTTGAAGATAATTAGGTAAATATCAACTGGAGA
GACGACATCGATGAGAAAGATAAGAAGTAGTAAAAGCTTAACTATGGAGCAAAGAAGGAA
GATGTTGTGGGCCTGCCAAAATATAAAACTAAAACTCAAAAAGAGCGCTATAATAATAAA
GCACTCAGATAAACAGGAGTAAGAAGAGAGTTTGAATTGTGA


>Contig14329.0.g31(protein)
MKSRKSPAKPSSTTPLSTANQQPQEVVKDSQNQQNAAPPTKKNHGRQAKHEEIKIRHHTT
ITATSQKQITETGVNELREYAFKDEPCEIGIDEAGRGPVLGPMVYGCTFWPISQRDEFKK
QYKFTDSKQLNEQQREEMFEQIKSCEFSRLGYFTAVLHADYLSNLMLAEMKSGGKNLNTI
SHDTAIDLIKKVKALGVNVKRVVLDTVGQPHSYKQLLHNRLKDDELEIIVESKADLNHPV
VSAASICAKVTRDQVLADWQFPEDKKIDTDYGCGYPGDPKAKEWLKRNLDPVFGFPTLVR
FSWKTCSTILEDNQVNINWRDDIDEKDKKQQKLNYGAKKEDVVGLPKYKTKTQKERYNNK
ALRQTGVRREFEL