Identifiers and Description

Gene Model Identifier

Contig15100.0.g35

Standard Name

RNF9

Aliases

Contig15100_0_g35

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13639 ) Ring finger domain
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam04423 ) Rad50 zinc hook motif

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000592803.998609120989657e-17hypothetical protein
SGDYDR143C0.000009999254677478949SAN1 SGDID:S000002550, Chr IV
from 743874-742042, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15100.0.g35(coding)
ATGGATGAAGAAATGGGCCTTAAATGTTCAAATTGCAGTGGCTATTTTTGCGAAGTACTA
GAAAATGAATATGAGCAGACATATTAGCATCCAGCTGAATTTCAACCGTTCCAACTTATG
AGTTGGGAAAATAATATTGATGATGACAATTCAATCGAAGCTTTATCATTAGAAAATACT
AGATCCCCTTAAAGCTCAAGTGGAAACAACAATAGATCAAATTTATCTCCAATTACAGAG
GCACACCTTGGAGACTCTTTAAGATAAACTCAAAACTAAGCCTAAGAAAGCCCTCTAACA
ACTCCATAAAACTAAGGGAATTCTCATTAATTAGAGGAGTTACCACTTGAGCTTGAAAGA
TAGCTCAATGCGATCTCGGGAGGTTCAGTTGATGCGTAGGCTGTCTAAAATAATGAAATT
TTAGGAACTATTCTGGAAATGGCTTTGCAAAGAATAAGAACCAATAATCGAGAGTTCAGT
AATGCAGTCCTAACTAGAGCTTATATCAGAGTTATGGGTAGTAATCCCGCTCCCTCATTC
AGAAGGCGAAGATTAATGTAGGATTTCGGATAACTGTACAACGATAGTCCTTAGGGTATA
TTTTAAGACATAATTGAAGACTACATAGAGAGACCTGAACTACCCTCACTAGGCTCAGGA
GGCTTTTTCAGCAATTACATTGAGTAGCTAATTTAGCAACTATCCGAAAATGATATAAAT
CGCTTTGGAACACCACCAGCTTCAAAACAAGCAATAGAAGCTTTAAAATAATTTTAAGCT
AAGGATTTTTAAAATTCCACGGCAGATTGCTGTGTTTGCCAAGAATTATTGAAAGATTAT
GAGGAGTCATAATCCGTTTCAACTTAATAGAAAAATCTAAGCTAGTAGCTAATTTCACCT
AGGAGCAATAGACAAGCACCGAATTAGAACTAAGAAACTTAAATTGAAGATAAAGATTAA
AGCAATAGAGTACCTAAGATTTTAGAGATGCCTTGCTCACATTTATTTCATGATGAATGC
TTACTTTCATGGCTAGAAAAACATAATAGTTGCCCAACATGCAGACATGAGCTGCCAACC
GATGATATAGATTATGAAAATAGAAAAAGATAAAGAATATCAGCACCAGCTTAGTCATAA
GGCACTTCTTAATAAACAAATAACTCAATAAATAATAATCACTAATAAATACTCTAAAAT
CATATTGAAAGGGCAGTGGGACATAACGGCTTCAACTAAAGTAATAATAATAATAACTGA


>Contig15100.0.g35(protein)
MDEEMGLKCSNCSGYFCEVLENEYEQTYQHPAEFQPFQLMSWENNIDDDNSIEALSLENT
RSPQSSSGNNNRSNLSPITEAHLGDSLRQTQNQAQESPLTTPQNQGNSHQLEELPLELER
QLNAISGGSVDAQAVQNNEILGTILEMALQRIRTNNREFSNAVLTRAYIRVMGSNPAPSF
RRRRLMQDFGQLYNDSPQGIFQDIIEDYIERPELPSLGSGGFFSNYIEQLIQQLSENDIN
RFGTPPASKQAIEALKQFQAKDFQNSTADCCVCQELLKDYEESQSVSTQQKNLSQQLISP
RSNRQAPNQNQETQIEDKDQSNRVPKILEMPCSHLFHDECLLSWLEKHNSCPTCRHELPT
DDIDYENRKRQRISAPAQSQGTSQQTNNSINNNHQQILQNHIERAVGHNGFNQSNNNNN