Identifiers and Description

Gene Model Identifier

Contig15239.0.g116

Standard Name

RNF8b

Aliases

Contig15239_0_g116

Description

FHA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002183703.00033207980219e-32FHA domain containing protein
SGDYOL054W0.000050024383570459175PSH1 SGDID:S000005415, Chr XV
from 228614-229834, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15239.0.g116(coding)
ATGGAAGCATTTGAAGGAGACCCTTAAAACCCCTTAAACTAATCCATAATCCCAGAGGGG
GTTTGGGGTAAATTGAATTCGATATCAAGGAGAGCGAAGAATTAAGAGCTTAAAAATGAA
TAGTTTACGATTGGCAGGACCCCCAATAATTCTTACTAAATTTAAGACTAAAAGATCTCT
GGCACTCACTGCAAAATCAGTATGAGAGTCGATGAGGAGAGTGGCAAGATGATTGTTTCA
TTAGAGGACACATCAAGTAATGGAACTTATTACAATGGTGAAAAATTGAGCAAAGGATAG
ACCAGAGACCTAAAAAATGGAGATGAAATTCATTTATTGAAAGAGATAGAAGGAGCTGTA
GACTCATCAGAAGAAATAGGTTTTATCTTTGTTTTGCTAAAAGATTACTCAAGACCTGAT
CCATCCCAACAACAAATACTGAACCAGTCACTTTTAAAGTCTTAAGAGAAAGAGAGAAAT
AGTAAAAAGCGTGCCTATGAAGAGATCACTGTCACAAAGGAAGAGTTGGAAGTTAAGATT
TAAGAAGAGAAAGTTATGCAGTAAAAGATATCATCGATGGCTGATTAGTTTGACTGTGGT
ATTTGCTATATGACCATGCATTAAGCTGTGTCTTTGATGCCTTGCTTACACACTTTCTGT
GGAGGATGCTTTTCTGATTGGATGACAAGAGCCAAAGACTGTCCAAGCTGCCGTGAGCCC
GTGACTGAAGTGAAAAAGAACTCCCTAATTAATAACTTAATAGAAAACTATCATTCTCTG
AACCCAAATTTGAAACGAGACCCCAAAGACCTCGAGAATTTAGAGAAATTAAACATTTTC
AAGAATGAATCTGTCAAAATAGAGCAACCTAAAAAGGAAGAACCACCAAAACCAGCTTAA
ATCCCTCATTTATAACCAATCTATTAGTAGCAACCATAGCCTCAGTTTTAATTTGGCTAA
GGTTGGAACTTATTCGGGAACAATAATAATAACAACAACCAAGTTAGAAATCCATTTGGG
GGAATCTTCGCTTAAAATGTCTCTTAACCAGTAAACTTTGAAGAGAGAAGAAAATAAATA
ACTGAACAGAGACAAAAGATTTATGAAGAACAGCAGAAAAAGCGAAGAGAGAAATACGAA
GAGAGAAAGCTATAAGATAAGAAAAAGGATGCAGCAAAAAAGAAAAGAAACACTTCATCG
TCATCAAATAGTGAGGAATCTGAAGAGAGTGAAGAAAGTGAGGATAGTGAGTCAGATGAA
TCTGAATAAGTTTCAAGGCCAAATGCGAGATAGAGAAATGCCTCAGTAGCCAATGACAAT
AAGAATAAGAAGCTAGATAAGAAAATACCAGCTAAGAAACTAAGCAACAATAAAGCCGCT
AGATCTCATTTGACAACCTTAGAAGTAACGACGATAGATAGCAGCTCGAATTATTCCGGT
TCTGATGTCTCACTTCTAGAGAACAGCGATGATTCTTCTGATAAATAAAAATCTTAAAGT
CTGCTGAACGTTAAAGGAATATAAAAAATTGAAAATGTTAAGGGAGTGCAGAAATAAAAC
AATAAACAAGTTAAGCCTGTGGAAGAGAAGAAATAAGGGTAAAAAATAGCTGTGGCTTAA
ATCAGAAATAAGCCAGTATTAGCTGGAAATGATAAGAAAAATCAAGAAGAGGAAAATAAA
TAGGTTATAAAAGTCAGAGGTGCTGCTCTTTTTAATGAAAGAGGAGCATTACCAGCTGGA
AAAAAAGAATGCAAGAATTGCACAGAAATGTCAGCTGATATGTTTCTTTGTAAAAAAGAT
TAACAACATTTAAAATGCACTAACTGTGAGCAATTATTCCCCGAGAGAAATCAATTCGAT
CAAATGTGCTATTTATGTGACCGTAATTTCTGCAATTTGTATTGGGAATGCCCCAAAAGA
GCCTAAAATCCATTAGCATAACTTCAAGAACACAAAATAAATCTGAATGTAAACAGAAAC
TATTCAAACGCAGACGACTGGCCTGAGCACTAAAAAGTGACAATTGAAAATATCATGAAG
GTCTAAAAGTTAACTCCCGCACGTTTGGCTTAATTTATTTACCAAAACCATCTCAAAAAT
ATGGTATTCAGGAAGAGATTCGTCAACCAGGGTGAAAACGATGAAGTGAGAGTGCTTGCA
ATCACTCCCGTGTGTAAAATGTGCTCAATGGACATTCATAGTCAGATGTTGTTGCAATAC
ATCGAAATTAAGTTTGGAGACAAGAAGAATAATGGTAACGAAGAGGAGAAGAAAAAAGAG
GAGAGAGAAAATCAAGTTAATAATAACGGTAGATATGTCAAACCAAAGAAAATGAATTTC
AAATGA


>Contig15239.0.g116(protein)
MEAFEGDPQNPLNQSIIPEGVWGKLNSISRRAKNQELKNEQFTIGRTPNNSYQIQDQKIS
GTHCKISMRVDEESGKMIVSLEDTSSNGTYYNGEKLSKGQTRDLKNGDEIHLLKEIEGAV
DSSEEIGFIFVLLKDYSRPDPSQQQILNQSLLKSQEKERNSKKRAYEEITVTKEELEVKI
QEEKVMQQKISSMADQFDCGICYMTMHQAVSLMPCLHTFCGGCFSDWMTRAKDCPSCREP
VTEVKKNSLINNLIENYHSLNPNLKRDPKDLENLEKLNIFKNESVKIEQPKKEEPPKPAQ
IPHLQPIYQQQPQPQFQFGQGWNLFGNNNNNNNQVRNPFGGIFAQNVSQPVNFEERRKQI
TEQRQKIYEEQQKKRREKYEERKLQDKKKDAAKKKRNTSSSSNSEESEESEESEDSESDE
SEQVSRPNARQRNASVANDNKNKKLDKKIPAKKLSNNKAARSHLTTLEVTTIDSSSNYSG
SDVSLLENSDDSSDKQKSQSLLNVKGIQKIENVKGVQKQNNKQVKPVEEKKQGQKIAVAQ
IRNKPVLAGNDKKNQEEENKQVIKVRGAALFNERGALPAGKKECKNCTEMSADMFLCKKD
QQHLKCTNCEQLFPERNQFDQMCYLCDRNFCNLYWECPKRAQNPLAQLQEHKINLNVNRN
YSNADDWPEHQKVTIENIMKVQKLTPARLAQFIYQNHLKNMVFRKRFVNQGENDEVRVLA
ITPVCKMCSMDIHSQMLLQYIEIKFGDKKNNGNEEEKKKEERENQVNNNGRYVKPKKMNF
K