Identifiers and Description

Gene Model Identifier

Contig114.1.g104

Standard Name

RNF8a

Aliases

Contig114_1_g104

Description

FHA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002183701.0003081162615753e-33FHA domain containing protein
SGDYOL054W0.000019995566179747357PSH1 SGDID:S000005415, Chr XV
from 228614-229834, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig114.1.g104(coding)
ATGGCTGATCGCTCTAATAACTAAAATCAATCTCAAAATAGTAACCCAGACTAATTAGTT
GAAGTATGGGCTCGACTGAATTCCCTGAATAAAAAGTTTAAGAGTAAGGAGATTAAAGAA
GCAAATTTCTCTATTGGTCGGTTGCCTAAGAGTGAGATGCAAATCAAAGATCAGAGATTA
TCTGGAACTCACTGCATAATTAACAGAATGATTGATGAAAACGGAAAGATGATTGTTTGT
CTAGAAGACACATCTTCAAATGGCACCTACCACAATGGTGTACTCGTTGGGAAAGGATCA
ACTCGTGAACTTAAAAACGGAGATGAAATTATCATGTTAAAGGAGTGCGAGGGTGTCTCA
ACCGAGGATGAAATAGGATTTATCTTCGTGGTTTTGAAGGATTACTCAAAGGTCGAACAA
TAGCCAAATTCACAGTCATAATAGGATTAATTGCAATAGTAATAATAAGCTTAATAAGAA
TAATTAGAATTACAAATGCAATAATCAAGAATTGAAATGGAGCAAAGTAAAGAAGAACTA
GGGAAGAGGTAGAAGGAGGAATAAGAAATGAAAGCTAAGATAAGTATGATGGCAGATCAA
TTTGATTGTGGTATCTGCTACATGACAATGCACTAAGCTGTTACGTTAATGCCTTGTTTG
CATACTTTTTGCGGTGGCTGTTTCTCAGACTGGCTCTCTCGACAAAAAGATTGTCCATCC
TGCAGAGACTCAGTTGTAGAAGTAAAAAAGAACTCCTTAGTGAATTGCTTGATAGAGAAT
TATCTCATCCTTAACCCTTAATAGAAGAGAAGCGAAGACGAAATTAAGGATTTAGAAGGC
AAAAACATCTTCAAGAATGACACTATCAAAATTGAAACACTTGGGGATGTCAAGCAACTC
TAATTATAATAATAAAATCTCGCTAATCCCCCAGCAGCTGTACCAATCGTTGTATAACAA
TAAATTTAAGTCAAAGTCTCTCCTCAAGTTGTGAGAAAGGGCTTGAGAAAGTAAAATTCA
AAGAAAGTGGAAGAAGATATAAAAATGAAGGACGAGATTGAGGATTCAAGTGACTCTGAA
TCTAGCAACGAGGGAAGCAGTAGTAATGACTCAGAGAACGAAGATATTTAAGAAGTCCCA
AAACCCCTTGGCCGTGGAAATCTAGCGAGAAACTAAGCCAATAAAGCCAAGCCCAAAAAG
GCGGCTCCAAAAACTAAACCTATTCGAAAATTACCCCCTAGTATACTTGCAAAAGCTAAT
AAAGGCAAAGCTAAGAAATGA


>Contig114.1.g104(protein)
MADRSNNQNQSQNSNPDQLVEVWARLNSLNKKFKSKEIKEANFSIGRLPKSEMQIKDQRL
SGTHCIINRMIDENGKMIVCLEDTSSNGTYHNGVLVGKGSTRELKNGDEIIMLKECEGVS
TEDEIGFIFVVLKDYSKVEQQPNSQSQQDQLQQQQQAQQEQLELQMQQSRIEMEQSKEEL
GKRQKEEQEMKAKISMMADQFDCGICYMTMHQAVTLMPCLHTFCGGCFSDWLSRQKDCPS
CRDSVVEVKKNSLVNCLIENYLILNPQQKRSEDEIKDLEGKNIFKNDTIKIETLGDVKQL
QLQQQNLANPPAAVPIVVQQQIQVKVSPQVVRKGLRKQNSKKVEEDIKMKDEIEDSSDSE
SSNEGSSSNDSENEDIQEVPKPLGRGNLARNQANKAKPKKAAPKTKPIRKLPPSILAKAN
KGKAKK