Identifiers and Description

Gene Model Identifier

Contig23033.0.2.g93

Standard Name

RNF8

Aliases

Contig23033_0_2_g93

Description

zinc-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig23033.0.2.g93(coding)
ATGGAAAGTTTAAGTCAAAACAATTTTGATTTCTCACTTTCAGATTAGCTGACTTTATCA
GTTAATTACTGGTGCCATACTTGCAAGTAATAAGTCCTATGCTCTATGGATGAAGAAATG
GGCCTTAAATGTTCAAATTGCAGTGGCTATTTTTGTGAAGTATTAGAAAATGAATATGAG
CAGACATTTTAGCATCCGGCTGATTTTCAACCGTTCCAACTTATGAGTTGGGAAAATAAT
ATTGATGATGACAATTCAATTGAAGCTTTATCATTAGAAAATACTAGATCCCCTTAAAGC
TCAAGTGGAAACAACAATAGATCAAATTTATCTCCAATTACAGAGGCACACCTTGGAGAC
TCTTTAAGATAAACTCAAAACTAAGCCTAAGAAAGCCCTCTAACAACTCCATAAAATTAA
GGGAATTCTCATTAATTAGAGGAGTTACCACTTGAGCTTGAAAGATAGCTCAATGCGATC
TCGGGAGGTTCAGTTGATGCGTAGGCTGTCTAAAATAATGAAATTTTAGGAACTATTCTG
GAAATGGCTTTGCAAAGAATAAGAACCAATAATAGAGAGTTTAGTAATGCAGTCCTAACT
AGAGCTTATATTAGAGTTATGGGAAGTAACCCTGCTCCTTCATTCAGAAGGCGAAGATTG
ATGTAGGATTTCGGATCACTTTACAACGATAGTCCTTAGGGTATATTTTAAGACATTATT
GAAGATTACATAGAGAGGCCTGAATTACCCTCACTTGGTTCAGGAGGCTTCTTTAGCAAT
TACATTGAGTAGCTAATTCAGCAACTATCCGAAAATGATATAAATCGCTTTGGCACTCCA
CCTGCTTCAAAACAAGCAATTGAAGCTTTAAAATAATTTTAAGCTAAGGATTTTTAAAAT
TCCACTGCAGATTGCTGTGTCTGTTAAGAATTATTGAAAGATTATGAGGAGTCATAATCC
GTTTCAAATTAAAAGAAAAATCTAAGCTAAGAACTAATTTCACCTAGGAGCAATAGACAA
GTACCGAATCAGCCAACTTAAATTGAAGATAAAGATTAAAACAATAGATTGTCCAACATG
CAGACATGA


>Contig23033.0.2.g93(protein)
MESLSQNNFDFSLSDQLTLSVNYWCHTCKQQVLCSMDEEMGLKCSNCSGYFCEVLENEYE
QTFQHPADFQPFQLMSWENNIDDDNSIEALSLENTRSPQSSSGNNNRSNLSPITEAHLGD
SLRQTQNQAQESPLTTPQNQGNSHQLEELPLELERQLNAISGGSVDAQAVQNNEILGTIL
EMALQRIRTNNREFSNAVLTRAYIRVMGSNPAPSFRRRRLMQDFGSLYNDSPQGIFQDII
EDYIERPELPSLGSGGFFSNYIEQLIQQLSENDINRFGTPPASKQAIEALKQFQAKDFQN
STADCCVCQELLKDYEESQSVSNQKKNLSQELISPRSNRQVPNQPTQIEDKDQNNRLSNM
QT