Identifiers and Description

Gene Model Identifier

Contig3652.0.g109

Standard Name

RNF7

Aliases

Contig3652_0_g109

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13639 ) Ring finger domain
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam14369 ) zinc-finger
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit
  • ( pfam04564 ) U-box domain
  • ( pfam09723 ) Zinc ribbon domain
  • ( pfam07975 ) TFIIH C1-like domain
  • ( pfam14447 ) Prokaryotic RING finger family 4
  • ( pfam05883 ) Baculovirus U-box/Ring-like domain
  • ( pfam04423 ) Rad50 zinc hook motif
  • ( pfam06467 ) MYM-type Zinc finger with FCS sequence motif

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000592801.9991095569230066e-20hypothetical protein
SGDYLR247C0.00000039992052383199455IRC20 SGDID:S000004237, Chr XI
I from 633354-628684, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3652.0.g109(coding)
ATGAATCAACAAGTTAACCAATCACATGTTGAAAACTAACAACAAGCGTCTACATCATAC
AGACTAGTTTAAAAGAAGTTTTTCTGTCATGTGTGCAACAAAGATTTTAAGAAAATGAGT
CCAGTTATTGAAATGAGTGAAGTTGAGTGTCCTGATTGCTAACAAACTTTCTGTGAGGAA
ATTTCCAACCATCAACAAGTTAATCTGGTCAGAGCTTCAGCTTAAGGTATATAAGCTCAA
CAGAGGCAACCATTAACTCCTGCTAGTCCTGCTTAACAATAACAAACATCAGTTAATCAA
GCCGTATCAAGAAGTTAAAACGGAAATGAAGATTTGATTAACAACATGATGCGTGGAATT
TTCTCTCAGCCTCAGACATTAATCAGATAAGTTAATGTTCCACAAACAAGAAGAGTAGTC
CGAAGTATCATCACTGATTCCCAAGGAAACTAAGCTATCATCGAGGAAATTTATGACGCT
CCACAACAGCCCAGATAGCAAAGCATGATCATCATTGATGAATCTCCAATCATCGGCTAA
GGAAACTTAGGAAGAGTTCCTCTTTTGTTTGGCCTCAACCCATTTGAAATGAACTTCAGG
TCTTCTGTGAATGATAACGTGCTCGAACAAATTCTCAGAATGTCAATGCAAGATAGAGGC
AGATCTGGCACCCCTCCAGCTTCAGAGCATGCAATCAAAAACTTGCATGAAGTTTAAATA
TCTGAAAAACTTTGCAAAAAGAATGAGAAGGACGGATCTCTTGAACAACCAAGATGCACT
ATCTGCTGTGAAGATCTTGTGGACAAGGCAACTATGTTACCTTGTGGTCACATGTTCAAC
AAGGAGTGCATCAGTGAATGGCTTCATTAACATAATCAATGCCCAGTTTGCAGATATGAA
CTGCCCACTGATGATGCTGAATATGAAGCTAAGAAACTTAGAGAAACTAGTAACAGTTCA
TAAGGCAATTCAAGATAGGCTGACGAAACAATTCATTCAAGAAACTAATCTTACTAACAA
AATTATCCTCAATTCTGA


>Contig3652.0.g109(protein)
MNQQVNQSHVENQQQASTSYRLVQKKFFCHVCNKDFKKMSPVIEMSEVECPDCQQTFCEE
ISNHQQVNLVRASAQGIQAQQRQPLTPASPAQQQQTSVNQAVSRSQNGNEDLINNMMRGI
FSQPQTLIRQVNVPQTRRVVRSIITDSQGNQAIIEEIYDAPQQPRQQSMIIIDESPIIGQ
GNLGRVPLLFGLNPFEMNFRSSVNDNVLEQILRMSMQDRGRSGTPPASEHAIKNLHEVQI
SEKLCKKNEKDGSLEQPRCTICCEDLVDKATMLPCGHMFNKECISEWLHQHNQCPVCRYE
LPTDDAEYEAKKLRETSNSSQGNSRQADETIHSRNQSYQQNYPQF