Identifiers and Description

Gene Model Identifier

Contig13791.0.g64

Standard Name

RNF5

Aliases

Contig13791_0_g64

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13639 ) Ring finger domain
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam05701 ) Plant protein of unknown function (DUF827)
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam12906 ) RING-variant domain
  • ( pfam14446 ) Prokaryotic RING finger family 1
  • ( pfam04156 ) IncA protein
  • ( pfam11793 ) FANCL C-terminal domain
  • ( pfam14362 ) Domain of unknown function (DUF4407)
  • ( pfam12329 ) TATA element modulatory factor 1 DNA binding
  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit
  • ( pfam08581 ) Tup N-terminal
  • ( pfam10186 ) UV radiation resistance protein and autophagy-related subunit 14
  • ( pfam08746 ) RING-like domain
  • ( pfam10367 ) Vacuolar sorting protein 39 domain 2
  • ( pfam05883 ) Baculovirus U-box/Ring-like domain
  • ( pfam01496 ) V-type ATPase 116kDa subunit family
  • ( pfam04508 ) Viral A-type inclusion protein repeat
  • ( pfam07851 ) TMPIT-like protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005304402.999534586690157e-23hypothetical protein
SGDYBR062C0.000004000864880866421YBR062C SGDID:S000000266, Chr
II from 366502-365976,366...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13791.0.g64(coding)
ATGCAAAGAAATCAGATAACTTACAAAGGACCAAATCCTTAAAAAGAATATACTAACAAC
CCAGCGGCTAAATTACGTGGCCAATCAACAAACAACTTTAGCCAAAGGCCAGGCTCTAAA
AAAGCTTCAGTTTTGCAGATGCAAAATACCAAGTCAAATTTTGAAATGAATAAAAAGAGT
ACAACCTAAGAGTGGGGTAATAACATGAATATCAATTCAGCTGCATCTGTTATTGGAATT
AATGGAGCACTTCCTTAAAATTTACCAACAATCAGCAACAGCGGCCTAGCATAAAACAAT
ATCTCACCTGCTATTTATTCTAATAAAGCTTCAGATATTGTATCCAACATAATTGGAGGA
TAAAAGCAGCAAATATCCATGTATGATTCAGCTAAAAACTCTTCTAACGATGAACTTCTG
AGATTACGTTAAGAACTTCAACTCGCATAGAAACAGCTTGTAGCCTTCAAAACTTCTGAT
GATGAAAAAAGTAAGAAAATAGAGCAACAGAGAGCTGAGATCACTAAGTTAAGAAAAGAA
AACATTGAATATAACTCATAAATCAATAGGTTGAAGAACAATCTGGACGAGGAAAAGAAA
AAAGTTAAAGATCTAAGAGAATAAAATAGAAACACTCAGGGTGGTAGAGGAACTTCAACA
GGTAACAGTCAAGCTGATAAAGATTTGGAGGAGATTAGAGCGCTATAATTGGCTATGCAA
TTTGAAGATCAGGAGAGGAGACACAGGGATAGAGACATGATGCTTACGATGATGTTGGGA
GGTCATCCAATGTATGGAGGAAATTCTTAGCAACTTCTGGAGTAACAGCAACTGCAAAGA
GTGATCGAAGAATCAAAGCAAGACAACCCTGATAACATGACTTATGAATAAATGTTAGAG
CTAGGTGAACGAATCGGAAAAGTATCCAAAGGTCTTACTTAGCAATAAATCTCAAAAATT
CCATGGAAGTTCTGGAGAGCTTCACTAACAAAGAAGACCGATTGCTCTATTTGTTTTGAG
GAGTTTGCTGATAACCAGAAATTTAAAGTACTGCCTGACTGCTTGCATGAGTATCATCAT
GATTGCATTAATAAGTGGCTTAATGAAGAAAAGAGGTGTCCTGTTTGTAACAAAGATGTA
ATCATCAGTCCATGA


>Contig13791.0.g64(protein)
MQRNQITYKGPNPQKEYTNNPAAKLRGQSTNNFSQRPGSKKASVLQMQNTKSNFEMNKKS
TTQEWGNNMNINSAASVIGINGALPQNLPTISNSGLAQNNISPAIYSNKASDIVSNIIGG
QKQQISMYDSAKNSSNDELLRLRQELQLAQKQLVAFKTSDDEKSKKIEQQRAEITKLRKE
NIEYNSQINRLKNNLDEEKKKVKDLREQNRNTQGGRGTSTGNSQADKDLEEIRALQLAMQ
FEDQERRHRDRDMMLTMMLGGHPMYGGNSQQLLEQQQLQRVIEESKQDNPDNMTYEQMLE
LGERIGKVSKGLTQQQISKIPWKFWRASLTKKTDCSICFEEFADNQKFKVLPDCLHEYHH
DCINKWLNEEKRCPVCNKDVIISP