Identifiers and Description

Gene Model Identifier

Contig4325.0.g74

Standard Name

RNF4

Aliases

Contig4325_0_g74

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004446000.0000000000002999981760818895hypothetical protein
SGDYKL034W0.000019995566179747357TUL1 SGDID:S000001517, Chr XI
from 371829-374105, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4325.0.g74(coding)
ATGACCCCGATATATCCAATAGTAATTTCTTATTCTTAATATTCATTACTATCAGACTAC
GATAATGATTAAAGTCAAGCTACAGAGAGATCAGAGATGTTTAATGAAGCAGATTTAGAA
CAGAATTCTCTATAGATTGATGAGAATAATGTGACAACCGGGGATGATGAAGATGAAGAA
GAATCTTAAGAGTTTAGGGAGTTGCAAAGACTAGCTTTGGAAAGTGAGATTCCTCCTCAA
AAGTCTTGTGGAGACTAGTTTTTATTAATAATGAATGGATGCTTGAGTATTATTACGAAG
GGATTTTACTACTTGGCTTTACTGGTCTACCATTTATTCACCACTCTTATTGCTGTAGTT
AACTCAGGCGCTTTTGTTTTCAACGATAACTCTACTTTTCGCATTCAATATATTGACGTT
GAACTTTGCCATATGGATATTTGTGGTGCTAAGCATGCTGTTTCTAATCTTCAAAATCTG
TCTACAACAATTTAAGATTTGAGTGGATTGTTCGAAATTGAAGTGACATCAAGAAGACAA
AGATAAATCAGGAGATCTCAAAGAAATGGGAGTAACAGGCCCTATTCAGTAAATCATAGG
CGCATTGGCAGAGATTACGATAGAGTCTATTAATAAGATAGAATTAGAAGGATGAGAAAT
TCATCATTAAGAGAAGAGATAGATGTGCCTATGACTGAACTAACTTCAAATATTCCTCAC
TCTATAAGATACAGAATATCTGCCATCGACAATTAATTTATAACTGAAGACTCAACCGAG
AGATTAGCTACTTAAGGAAATGATAATCATTCGTAAATCGATGAGCATGTGTTGAGGATG
TAAAGACACAGAGATTAACGTATTCGAAGAGATTTTATTAGAAATGAAATACTTAGAGTG
TTAACTTCGTCGGACTTTGAGAGAAGTAGAGGAGGCAGCAACAGAAACTCATTTTTGCTT
AGAAATTTATAGTACTTGCAAATGTCCTCAATTGCTAGAGACTTTAACGAAAATGATTAT
GAAATGTTGTCTAACTTAGACAACTCAAATTATAGAAGAATCTCTTCAACTAAGACTCAC
TTACTTATTTCTCAATTGCCTACTTATGTCTTTCTTTCAAAGAAAACTAACAATACTGAT
TGTAAGGACACCTCAACTTTCAATGAAGACGATGAAGAAACTTATGGTTCTAACATAGAC
AATTCTAAAGTAAAGAAGGATATAGAATCAAAATCAGCAGACAAGGCTTGTTCTAGTTTT
GAAACTAGTCACAAAGACACTTGCACAATTTGTATAGAAAGCTTTGCAGACGAAGAAACT
ATCAAAATATTGCCATGCTTTCATTAATTTCATTCTACATGCATCGATGATTGGTTACTT
AGAAAAACTAATTGCCCAGTTTGTAAATTTGATATTAAGCAAGCTGCGAGAGATGAAAGA
TAACTCAATTATTAATTGCAAGAGGTTTGA


>Contig4325.0.g74(protein)
MTPIYPIVISYSQYSLLSDYDNDQSQATERSEMFNEADLEQNSLQIDENNVTTGDDEDEE
ESQEFRELQRLALESEIPPQKSCGDQFLLIMNGCLSIITKGFYYLALLVYHLFTTLIAVV
NSGAFVFNDNSTFRIQYIDVELCHMDICGAKHAVSNLQNLSTTIQDLSGLFEIEVTSRRQ
RQIRRSQRNGSNRPYSVNHRRIGRDYDRVYQQDRIRRMRNSSLREEIDVPMTELTSNIPH
SIRYRISAIDNQFITEDSTERLATQGNDNHSQIDEHVLRMQRHRDQRIRRDFIRNEILRV
LTSSDFERSRGGSNRNSFLLRNLQYLQMSSIARDFNENDYEMLSNLDNSNYRRISSTKTH
LLISQLPTYVFLSKKTNNTDCKDTSTFNEDDEETYGSNIDNSKVKKDIESKSADKACSSF
ETSHKDTCTICIESFADEETIKILPCFHQFHSTCIDDWLLRKTNCPVCKFDIKQAARDER
QLNYQLQEV