Identifiers and Description

Gene Model Identifier

Contig20306.0.g56

Standard Name

RNF3

Aliases

Contig20306_0_g56

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam13639 ) Ring finger domain
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam12906 ) RING-variant domain
  • ( pfam04478 ) Mid2 like cell wall stress sensor
  • ( pfam06024 ) Nucleopolyhedrovirus protein of unknown function (DUF912)
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam08733 ) PalH/RIM21
  • ( pfam06305 ) Protein of unknown function (DUF1049)
  • ( pfam05434 ) TMEM9
  • ( pfam08693 ) Transmembrane alpha-helix domain
  • ( pfam12669 ) Virus attachment protein p12 family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004260100.0000000020002373268528243hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20306.0.g56(coding)
ATGGTTATGTTTCAGTCTTCCCACTCACTTAATTCATTGCAGCCAGCTAAGATAAAATAA
TAAACTAGTTAAACAAATTTCACAGTTTAAGCTGATAAATCCTACAACCTGCAAGTTAGT
GAAGTAAATTTCGGGGAATATGTTTCAATTGCTTAGAAGACAGCAGTTATGACATTGTTT
TATAACACGGATGACAACAGAATACTAAACTATACAAATAACTCATTCCAAATAAATAGC
TAACTCAAGGATCTGACTGTGCTCAATGGATATTTTCAAGATCCTTATCTGTTCGTGCAC
TTTCGAGTAGACCCTAATAAATATGACAATAAAGGCAGCATGAATAACGATGGCATCACT
CCAAACAATGGATTCGATGGAGGGGATGACGATGATGTGAGCAGTGATGATTTGCAGGTC
GTTCAAGCATACAACTTAAAAAGTAGCAAGGAACCTTTTTTATTACTCGACTCTTGGGTT
TACTCAATGTAAATATACAAGTCAAGTAATGAGTTTTAATTGTACTGTAACCGAAAAGCT
ACTGATGGCAGCATATATTTATTAGCAAAAAGTCTAAATAATTCAGGTTCTTTTACAGAC
TAAACGAAGGTAGATAATTGCGGGAAGAAGATGAAAGTAACCAAGTATTTTATTATCTAA
GGGTGTTCCTCAGCAAATTCCAATGCAGGAGTCATTACTATATATTCAAGATAAAAATTC
CAAAAACTTCAAGAAATCTATGGGACCAGATCGGAATCGAGAGTAGGTGACTAACTGTAA
ATTATTGAAAGTCCAGATCAGAATGAGATTCATGTGATAAGTACTCAATAGTACGGGAGC
TAGATGCAATATCAAATTATAGTAATAAACTTAATATTTGACCCAAGACTTTCAAGTTAA
TTCTCTTCGAGTCAACAATCCTATCCAACCCCTAACAACTACTTTTTTGATATTGCTTAC
TTTGACATTAGTACCTTAAGAGACGCCAATAACCAGGGAAATTTATATATAGGGGCTGGA
AAGAATTACGTGTTTGGACTCTTCGGCTATTTTGATACACTCTTTGGAATTCCACTATGC
GGCTACAAGGGGGAGGCAACCACAAACAAAACTGGATGTTAAGCTTGTCCTGCTGGATAG
TACGCCATTACAATTTAAGGTAAATGCACTCAGATAACTTAAAGTGGAAATTAAAACAAT
GCTAATCAATCTTCTTCCAATTTAACTGACAACATGCAGACAAAGATCCAATACATCTAA
CGAATATAAGAAATGTCAGGTGATTCAGATTCCTCCAAATACAGAGATTCTGACAATTCT
GATTCTGGAACTAATACCTTTAAATTAATCTTGGTAATCTGTATAGTAATCGGCATAGTA
GTGATTCTCATAGTACTCTTGTGCATTCTGAGGCACTTAATAAAAATAAGAAGGACCAGG
TCACAGTAGATAAGAGATATGGGGTAGGAAGAGAGTAATGGAATACCTAATTAAAGCGGA
GTAGGCGCTAATGGCCCTGTCATATTAGATATTGACATGAACAGAATCAGAAATATAAAT
AGGTACCGAGTGTCTGAGTCGATTAGTGATGAGCAAGAACACGATCGAATACTTTCCGAG
ATAAATCAAACTATGCCCTAAAAACTCTACGGCACTGCCGCTAATAAACTCAAAATATCA
ACTTGCAGCATTTGCTTTGAGGACTATGCTAAACAGGACCTGGTTAGAGAGTGCCCATGC
GATCACGTCTTCCATAGTTAATGCATATTAAGGTGGGTTAAGCAGAAATTACCAATTGCT
AATTGCCCTGATTGCAGAGTTTCACTCATCAAAGAACAAGAGATAATAATTTGA


>Contig20306.0.g56(protein)
MVMFQSSHSLNSLQPAKIKQQTSQTNFTVQADKSYNLQVSEVNFGEYVSIAQKTAVMTLF
YNTDDNRILNYTNNSFQINSQLKDLTVLNGYFQDPYLFVHFRVDPNKYDNKGSMNNDGIT
PNNGFDGGDDDDVSSDDLQVVQAYNLKSSKEPFLLLDSWVYSMQIYKSSNEFQLYCNRKA
TDGSIYLLAKSLNNSGSFTDQTKVDNCGKKMKVTKYFIIQGCSSANSNAGVITIYSRQKF
QKLQEIYGTRSESRVGDQLQIIESPDQNEIHVISTQQYGSQMQYQIIVINLIFDPRLSSQ
FSSSQQSYPTPNNYFFDIAYFDISTLRDANNQGNLYIGAGKNYVFGLFGYFDTLFGIPLC
GYKGEATTNKTGCQACPAGQYAITIQGKCTQITQSGNQNNANQSSSNLTDNMQTKIQYIQ
RIQEMSGDSDSSKYRDSDNSDSGTNTFKLILVICIVIGIVVILIVLLCILRHLIKIRRTR
SQQIRDMGQEESNGIPNQSGVGANGPVILDIDMNRIRNINRYRVSESISDEQEHDRILSE
INQTMPQKLYGTAANKLKISTCSICFEDYAKQDLVRECPCDHVFHSQCILRWVKQKLPIA
NCPDCRVSLIKEQEIII