Identifiers and Description

Gene Model Identifier

Contig7614.0.g57

Standard Name

RNF24

Aliases

Contig7614_0_g57

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam13639 ) Ring finger domain
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam11793 ) FANCL C-terminal domain
  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit
  • ( pfam12906 ) RING-variant domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005769600.000000000006001570085597868RING finger protein
SGDYLR247C0.00003998524687536623IRC20 SGDID:S000004237, Chr XI
I from 633354-628684, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7614.0.g57(coding)
ATGAATAATTAGGAAAATGATGGCTTCTAAGCAAACTCATATCAGAGTGACACTATCATC
TAAAATAACGCTTAAACTCACGATAGAGTTCACATCTGGAAATTTTTAGACAAATTATAG
TTAGAATTGTTAGAGAAACATTACAATTAATAAGAATATATTCAAGAAAGGGCTGTGAAT
ATCGGTGATTCATTGGTCAATATTCAGGATGGCACAAATGATGAAATATCTAATAATCAT
GAAGAGCTAAAAATTTCTATAAGTATTGGGGAATAGGATTATTATGTCGGCATTAACAAT
GCCGACAATCAAAGTAGCTATGTATTTGACTAAGGGTAAGTGCTTCTAGACACCTCTTTG
GATGATCAATCGAGCTTCACAACAGAAGTTATGAGCTTATCCGAATATAATGATATCGAT
GACGATGATAACTGGGAGAATCATTCTTAAAACTCTGTTATTGAAGCAGAACATTAGGAA
ATTCTGCTGCGTTTAACTGTTCCATCAGCTCCTGATGAAAACTTACTCCCAGTCATCAAC
TCTTATACTTCACAAGTATTCCAAATTAACGCAAATTCCAATGAAACTTGTTCAATTTGC
ATTGCAGATTTTGAATCAAATTGCTTGGTTAAGATTCTTAAGTGTTCTCACACATTTCAC
TCCAATTGCATTGATGAATGGCTTAAAATCAAACTTCAATGTCCTCTCTACAAGCAAACT
GTCTCTGAAAATTGTTCATGA


>Contig7614.0.g57(protein)
MNNQENDGFQANSYQSDTIIQNNAQTHDRVHIWKFLDKLQLELLEKHYNQQEYIQERAVN
IGDSLVNIQDGTNDEISNNHEELKISISIGEQDYYVGINNADNQSSYVFDQGQVLLDTSL
DDQSSFTTEVMSLSEYNDIDDDDNWENHSQNSVIEAEHQEILLRLTVPSAPDENLLPVIN
SYTSQVFQINANSNETCSICIADFESNCLVKILKCSHTFHSNCIDEWLKIKLQCPLYKQT
VSENCS