Identifiers and Description

Gene Model Identifier

Contig14437.0.g76

Standard Name

RNF22

Aliases

Contig14437_0_g76

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004719800.0000000000010000211161514907zinc finger protein
SGDYBR062C0.0000020007268868677913YBR062C SGDID:S000000266, Chr
II from 366502-365976,366...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14437.0.g76(coding)
ATGCTCTTTTTCGGGGCTGTAGCTGCAACCTGCTGGAAAATCAATGAAGATAAAGAATAC
TGGGATTAGGCGCCTTACCCTATCCATATATTTCTGATAACATAGCTAATACTTAAGATA
TGCTTGATACGACTACCATTTTTGATTCGCAGATAAAAACATCTTGACATCATAATGGCA
TTAAATGTACTTTTACTAATAGCAAGCACAATTACTGGGTTAATTTGGCTTATTAAAACT
AAACAAGAAGAGCCAGAATTCCTCACTACAAGCTACTATGTATCAACAATCATGCTTCTC
TCAATTCCCCTGCTGATTGCTTCATTTTTGATAGTGGCAACAATTATAGGTGTGGTTGTT
TTTATAACAACTAGACGTAGGCAGTTTGCTAGATTTAGAGATTTCTAAGATGAAGAAGTT
GATAACGGAGTGATAGACCAAGCTTAAATAGATGAAATAGTGGAAACCTACATGAACATG
TTAATAGAGTAAGATTTCGATAAGAAAACCTGTAAATTTAACGACTGTGCAATTTGCCTG
AAGGAATTTGAGAATGGCGAGAAACTCACTGAAATACCTAATTGTGAACATGTTTTTCAT
GAGGCGTGTCTTAGGAAGTGGTTTAGACAGCTGTAGATATGTCCAATGTGCAGGGGAAAT
ATTATTAAGATGCCTGGAGGAGGCAAGAAGAAAATATTGTAGAGGCAGTCTAACAATGGA
AATTAAAGCCAAAATCAAGGTAATCAAAGCAACAACGACAATTCTTACATTGGAGATGGT
TATGACATATAAAGATCTCAATAAAATCAAGTTTTCCAAGAAAATAACTAAAATTTGCAG
CCACCTCCAGCCAATTAAAATATCAATTAATAACCAGTAATTGATCTTGAAAATTCAAAT
AACAATAATGTTAACAGAGGAAGTCAAGGCAGTCAGCAAAGAAATCAGCATAGTTAAAGC
ATAGCAGCTGAGGGGTAGTTAAATTCTGGGAGATCAGGGGCCCCTGATGTATAAATATAG
ATTGAAGAGGATATGCAATAGTGA


>Contig14437.0.g76(protein)
MLFFGAVAATCWKINEDKEYWDQAPYPIHIFLITQLILKICLIRLPFLIRRQKHLDIIMA
LNVLLLIASTITGLIWLIKTKQEEPEFLTTSYYVSTIMLLSIPLLIASFLIVATIIGVVV
FITTRRRQFARFRDFQDEEVDNGVIDQAQIDEIVETYMNMLIEQDFDKKTCKFNDCAICL
KEFENGEKLTEIPNCEHVFHEACLRKWFRQLQICPMCRGNIIKMPGGGKKKILQRQSNNG
NQSQNQGNQSNNDNSYIGDGYDIQRSQQNQVFQENNQNLQPPPANQNINQQPVIDLENSN
NNNVNRGSQGSQQRNQHSQSIAAEGQLNSGRSGAPDVQIQIEEDMQQ