Identifiers and Description

Gene Model Identifier

Contig21637.0.g24

Standard Name

RNF21

Aliases

Contig21637_0_g24

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002703700.000000000029994712494008525zinc finger protein
SGDYBR062C0.000006997203421143941YBR062C SGDID:S000000266, Chr
II from 366502-365976,366...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21637.0.g24(coding)
ATGCCTAGATAAAATAAAAACGTAGCAAATTTAGTGAGAGGAAATAGGAGACTAGAGCAT
CGAGTGATTGGAAGACCAGTTGATTCGAGATTAGCAGTTCCTGTTCATGAATTTAGGATA
AATTAGGCTAATACAATTGAAGAGAATAAATACTCTACTCCTGTCATCAGAGAATCCAAT
TTAGTAAGAAGAGAAAGAATATCAAGCAATGAGATAGAAGAAATGATTAGAGGAAGCAAT
GTTACTATTAATAACACCAATCTAAATAATAGAAACTAAAATTAAGTAAGTAATAACTCT
CCATTTCCAAATCCAAGGGAAAGGAATCTGATTAGACCACCATCTAATTCCTCTTCAAGA
ATTGGATCCTCAAATTAAAACCTGAGAAATAATGGAAATATGATTATGAGTAATTTAAAT
AGAAACACAGCTATGAATTTTAATCCTATAAGATAGCCAAACACTATTTAAAGAGATTTA
TTTGAGGATGCTCCCAGGCAATTACGATAGCTTAATAACTTAAACGTGAGACCATACGAG
AATTTGATAAGGCAATCTAATTTTGAGGAATTTAAACTAGATTTCTTAAATGATCCTATA
CTTCCGAATAGAAATTATGCGATTGATTCCAATTCTGATACTGACAGTGAAGGATACAGA
GAACATAGATTTGAGTATAATTTAGAATAAGAAATTGAAGATTTGTTATCACCTGATCTT
TAGTTTTAAGCTAATGTGAATGATTTTAGATCAAATAACAGAGCTAATTAGTTGAGAAAT
CTTTCCAATAACAATAGAATATAATAGCAGTTATAAAATAGACAATAGCCTATGAGACAT
GGAAACTAAGTTGCTATACCCATAACAGAAAATATAAATTTGGGAATGAATAGAATGAGA
GGTGGTCTTCAAGCAATGAGGAGACGATTAGATGATTTGGATTCAATTTTAGACGACATT
GATTCTTTCCAAGTTGAAACCGATTAATTAGTCAGAAACATACAGTTCATAGAGAATATA
GTTGAGAGAGGCTAGGAAGACAAGAAATTAGGTTTGACTGAAGCAGGATTTAAGAAACAA
AAGAAAATCACCTACAAGAAGAAGGATGGCTAAGATACCTGCTCAATTTGTATTAAAAAT
GTGGCTGTTGATGAATAAGTTTATGAGCTGATTTGCAAGCATGTATTTCATGAGGATTGT
ATAGACACATGGTTTAAGCAGAGTCATTTATGTCCTAATTGCAGAAAAGATTTAAATTGA


>Contig21637.0.g24(protein)
MPRQNKNVANLVRGNRRLEHRVIGRPVDSRLAVPVHEFRINQANTIEENKYSTPVIRESN
LVRRERISSNEIEEMIRGSNVTINNTNLNNRNQNQVSNNSPFPNPRERNLIRPPSNSSSR
IGSSNQNLRNNGNMIMSNLNRNTAMNFNPIRQPNTIQRDLFEDAPRQLRQLNNLNVRPYE
NLIRQSNFEEFKLDFLNDPILPNRNYAIDSNSDTDSEGYREHRFEYNLEQEIEDLLSPDL
QFQANVNDFRSNNRANQLRNLSNNNRIQQQLQNRQQPMRHGNQVAIPITENINLGMNRMR
GGLQAMRRRLDDLDSILDDIDSFQVETDQLVRNIQFIENIVERGQEDKKLGLTEAGFKKQ
KKITYKKKDGQDTCSICIKNVAVDEQVYELICKHVFHEDCIDTWFKQSHLCPNCRKDLN