Identifiers and Description

Gene Model Identifier

Contig20755.0.g73

Standard Name

RNF19

Aliases

Contig20755_0_g73

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005304400.0000000039998859049333245hypothetical protein
SGDYMR247C0.00007000107212225429RKR1 SGDID:S000004861, Chr XII
I from 768039-763351, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20755.0.g73(coding)
ATGAAAGTTTATGCCAAGAGATAGCTTATAAACTTCTAGAAAGTAACTTTGTCGAAGAAG
GGAAAGAGATTATGTTCGCAGTACGCAGATTGCTATAATTGTTCGTTTACTTATGGAAAT
TGCAAATGGGATAAGAATAGTTAAGTGTGCAGTGACTTTAAATCAACTAAGTACTAAAAT
GAAACTGCCTATAAGTATGAATGGATAGACATGTTTGATAAATGTGAAGACAACCTTGAC
TTATGCTATGCAAGCGACAAAATATAAAGCTAAAAGGTTCTGAACAAAGATCAGTAATAC
ACCTTCTAAATGACATTAAAGAGTGACAACAATCTAGCGAGCTTGATTCCCTAGAACTAT
TTCTGTAATTGGACATTTGCAGCAGATTTACAAGCAGGGTACTTACTAACCATTCAAAGA
TACAGTAGGTATAATCTCGAAAACTTATATCTGAGGCTTCGATCTCCAGATTCAGTAGAT
AACTACACAGATGCTAATCTCGCTTATGGATCATCTATCGTGTAGTACAAAATCCTAAGA
ATCAATGGTATGTCAATTTATGCAAGAAATAACATAGGCCAAGGAAATTCAACTTTCATA
ATTACTATTCAATAAATATCTGATGATTCTTCCTCAGGTTCTGCTTTCGGTGTGATATCT
CTAGTTCTCTTTATACTAATGGGAGTCTTTATTGTAATATGCGCAGCCGCTATCATTAGA
GTTTGCATTAGAAAACGAAGAATTTCTTAAGTTGTAGAAAACTAAATTAGATTGCGAGAG
ATGCAGGATAGGTCTGATTAATCTAGAGTCAGTGAAGAATAATAGTAAAAAGATAGACTC
AATTTACTTATAAGCCTTATCAAAGAGAAAATATTCGACAGAAGAATGGATGAGTTCAAG
TAAAACGAATGTGTAATTTGCTTTGAAGACTTTCAAAAAGGTGTTAAAGTCAGAAAAATT
CCAACATGTAGGCATTTATTTCACACTACCTGTATAGATGGTTGGTTCTAATCTAAGATT
TAGGAAGAACTGCACAAATGCCCACTTTGCAACGGAGAAATTTCTATTGAGAAAGTTAAG
ATAGCTATCAAAAAAAGAAAGGAAGAGCGAAAACTTAGGGAACAGCAAAGAAATCAAAAT
GACAAAAGAGTTTCTATAAAGCCTTCAAAATCACATGGAAATCAAATTTAGTTGAAAATG
AATTTTGAAAATTAAGGCAACAGCTTGACTAATAATATTCTCAATAATAACATAAGAAGT
TAATAAACAGCTGTTAATGTTGGGCATTAAAACACCCTAGAGTTTGCTAGAGTTAACGTT
GTAAACTATGACACTAGTAATACTTTGAGAATTGATAATAACAATATGCAGACAAGCAAC
TCAATTACAATGAGCAGATAGAGTTTAACAGAAACCAGCAATAATTAATTGCTTATAAAT
GGACCATAGTAAGAATAATCTGTTCCTAGAAATGAATTATCTCAAGCACCACTTTCAAAT
GTTTGA


>Contig20755.0.g73(protein)
MKVYAKRQLINFQKVTLSKKGKRLCSQYADCYNCSFTYGNCKWDKNSQVCSDFKSTKYQN
ETAYKYEWIDMFDKCEDNLDLCYASDKIQSQKVLNKDQQYTFQMTLKSDNNLASLIPQNY
FCNWTFAADLQAGYLLTIQRYSRYNLENLYLRLRSPDSVDNYTDANLAYGSSIVQYKILR
INGMSIYARNNIGQGNSTFIITIQQISDDSSSGSAFGVISLVLFILMGVFIVICAAAIIR
VCIRKRRISQVVENQIRLREMQDRSDQSRVSEEQQQKDRLNLLISLIKEKIFDRRMDEFK
QNECVICFEDFQKGVKVRKIPTCRHLFHTTCIDGWFQSKIQEELHKCPLCNGEISIEKVK
IAIKKRKEERKLREQQRNQNDKRVSIKPSKSHGNQIQLKMNFENQGNSLTNNILNNNIRS
QQTAVNVGHQNTLEFARVNVVNYDTSNTLRIDNNNMQTSNSITMSRQSLTETSNNQLLIN
GPQQEQSVPRNELSQAPLSNV