Identifiers and Description

Gene Model Identifier

Contig1541.0.g49

Standard Name

RNF16

Aliases

Contig1541_0_g49

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam13639 ) Ring finger domain
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam09014 ) Beta-2-glycoprotein-1 fifth domain
  • ( pfam11793 ) FANCL C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005304400.000000000004997916451710233hypothetical protein
SGDYLR247C0.0000029996948234116693IRC20 SGDID:S000004237, Chr XI
I from 633354-628684, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1541.0.g49(coding)
ATGGAAAACAGTGAGACTGATAATAATAACCATCCACACTTGATAGATTTCTATTAAAAT
TAAATGGATGGTAACGAAACTAGTTACTAGGAAGGTAATGATTATGATAAGTACTGTACA
TATTATATCAGAGATTATAATTCTGAATATGAAGAGGAGCGAGAGTATGAAGTTGAGCAA
GATTATTATGTAGAACAAATTATGTAGAATGATGATATAAGAAGCTACACTGAATAAGTT
TGCAGGTCTTATGATTAAGAGGAAATCAATCATCCATCATATATTCAAGAATCCTAGAAT
CAACCTTTTACTCCAGATTACAACTTATAGGATGATAGTGATTTGGAATTAGAGTTTCAC
GAACCTGATGAATATACCTACACTAATCAAAACATATTTGAATTAAACTTGTATGATGAT
TCAGCTCCTATATCTGAACAACCAGATATAAATCAATATGAAGAGGACTACTCTGAGATA
GACTAGGCATTTGATGAACAATTTGATCCAGATTAATACCAATCTGATACTTCTAGTCAT
TAAAGAAGGCAGGAGGAAGAATATAATGAAGTGCTGCATTAATAATATGATGAAGAGTAA
AAATCAGATACTACAAGTTTTATTTAATGGTAGGAGGAAGTTTGGTAACATGAAGCCGAG
TAAATACAATTTTATGAAGAATAATAAGCAAGATTAGAATCTACTAGTAATCTTGAAAGG
CAACAACAGTAATATTATGAGGAATATATGCAATATTAAGAAAAATTAGAGTATTACTCC
GAGCCTCATTCATCAATTTAATCAGACACTTTCATTTAACTTTAAAGAGAGGAGGAAGAG
TATGATGAGCATACTGAAAATCAAGACTAAGCAGAATTGCAATATGAAGAATTTAGATTA
GTAGAAATATAAGATTTATCATAATTCAGATATGACAGTGATAATTAAGAGGAATTAAAA
CAATCTATTATCATCTCAATACCTTCACTTATATTCTACTAAATTGAAGGGACCGAATCA
CAGACTTGTTCAATTTGCATTGAAGATCTAAGATTTGGTTGTTTATTTAAGTAACTGAGA
TGTAATCACAAATATCACTCTAATTGTATTGATGGCTGGCTTATTCATAAATTACAATGT
CCACTGTGCAAAAGACAAGTTACTTAATTTGAAGAAGAATGA


>Contig1541.0.g49(protein)
MENSETDNNNHPHLIDFYQNQMDGNETSYQEGNDYDKYCTYYIRDYNSEYEEEREYEVEQ
DYYVEQIMQNDDIRSYTEQVCRSYDQEEINHPSYIQESQNQPFTPDYNLQDDSDLELEFH
EPDEYTYTNQNIFELNLYDDSAPISEQPDINQYEEDYSEIDQAFDEQFDPDQYQSDTSSH
QRRQEEEYNEVLHQQYDEEQKSDTTSFIQWQEEVWQHEAEQIQFYEEQQARLESTSNLER
QQQQYYEEYMQYQEKLEYYSEPHSSIQSDTFIQLQREEEEYDEHTENQDQAELQYEEFRL
VEIQDLSQFRYDSDNQEELKQSIIISIPSLIFYQIEGTESQTCSICIEDLRFGCLFKQLR
CNHKYHSNCIDGWLIHKLQCPLCKRQVTQFEEE