Identifiers and Description

Gene Model Identifier

Contig16909.0.g71

Standard Name

RNF13

Aliases

Contig16909_0_g71

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam13639 ) Ring finger domain
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam13894 ) C2H2-type zinc finger
  • ( pfam11793 ) FANCL C-terminal domain
  • ( pfam14446 ) Prokaryotic RING finger family 1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000592800.00000000002000577768187062hypothetical protein
SGDYBR062C0.0000009995106777214876YBR062C SGDID:S000000266, Chr
II from 366502-365976,366...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16909.0.g71(coding)
ATGAGTCAAAATCAGGAATTGAGAAATTGCAAATACTGTAATTAGAGATTTCATGTCTAA
AGTCTAGTTGCGCATGAGCTTCATCATGCTAAGGAATTGAGAAGTTAGGCACTATATGAC
AATTTCGGAAGTGGTTCAAATAGAAGCAATAACAGCAACTAAAATAGAAATAATGACTCT
GCCTAGTTCAAGAAGAACAATTTGTCAGATGATCTCAATGAATTTAACTTTGATTTGGGT
TTTACTATGAACTAGAGAAATCACAGTTCTCATGGCTTGGACTAAATTTAAGAAAACTTT
CCATCATCAAATAATTAATAATAAAACTTTGGAAATCGTTAAAATAGTACACATAACTCT
TTCTCAGCATTGGCTCAGGAACTTCATTTCACTACTTGCCCTCTCTGCCAAGACTAAATA
GTATAGGAGTTTGCAGATGAGCATCTCTCATAATGTAATGGAATACCAGAGAGAATTTAA
CCTCAGAGAATAGAGACTTCAAGTTTCAAATGCCCTTAATGTGCTTTAAGTTTTAACCAC
GAAGGAGAGTTTAATGATCATTTGGAGGCTCACTAAATAGCAGATCTCGAAAGTGGTTAT
AACAATAATTCTGACGATATGCAAATTAATGATATTCCAAATGCTTCTAGAAGAAATCCT
TTTGAAAATCCATAGAGCAGAAGAAGCTAAAGGCATGAGGAGGAGAGGAAAAGGTCTTCA
GATCCAAGTATGATACTAGGTGGTAACCCTAATGATATAATAGGTGCTAGACAAGGGTCA
CAGAATAATAGCAGACATAGAGAGCAAGCAAGATCTTAAAGATCATCTCATCATTCTTTA
AGTTAAATACTAAATTCTTTAAGCGGTGGACATAGAGGAGCTAGAGGTATCTAAATTATT
CAGTAATAACCAAATGGAAGACTTATCATTCAGAATGATCCTAATATGCAACTGTATGCC
TTAATGTCAGTCTTGAATCAAAGTTAGGGCAGAGCTGCCTTAGGTGATAATGTTCCAAAC
TTTGAGAACATGAATGAGCAGCAGATCTACGAGTATTTCACAAATTTGGACTAAAAAATC
AATCAGAAGCCTCTCTCAAGTGATATGATAGATTCACTTCCAGAAACAAAGTTCAAAAAG
AATGAACATGCTCATTAAGCGAACAACAACGGAGTGTAGGACGAAGAAGAGACAAAGTGC
TCGATTTGTCAGTGCAAGTATCTCGAGGGAGAAGACTTGAAGACTCTCACATGCTTCCAT
AAGTATCACAAGGAATGCATTTCTGAGTGGCTTCACAGACAAAACTTCTGCCCTATCTGC
AGAACTGAAATCAAAGTTTAATGA


>Contig16909.0.g71(protein)
MSQNQELRNCKYCNQRFHVQSLVAHELHHAKELRSQALYDNFGSGSNRSNNSNQNRNNDS
AQFKKNNLSDDLNEFNFDLGFTMNQRNHSSHGLDQIQENFPSSNNQQQNFGNRQNSTHNS
FSALAQELHFTTCPLCQDQIVQEFADEHLSQCNGIPERIQPQRIETSSFKCPQCALSFNH
EGEFNDHLEAHQIADLESGYNNNSDDMQINDIPNASRRNPFENPQSRRSQRHEEERKRSS
DPSMILGGNPNDIIGARQGSQNNSRHREQARSQRSSHHSLSQILNSLSGGHRGARGIQII
QQQPNGRLIIQNDPNMQLYALMSVLNQSQGRAALGDNVPNFENMNEQQIYEYFTNLDQKI
NQKPLSSDMIDSLPETKFKKNEHAHQANNNGVQDEEETKCSICQCKYLEGEDLKTLTCFH
KYHKECISEWLHRQNFCPICRTEIKVQ