Identifiers and Description

Gene Model Identifier

Contig2656.0.g41

Standard Name

RNF113B

Aliases

Contig2656_0_g41

Description

Zinc finger, C3HC4 type (RING finger)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and similar)
  • ( pfam13639 ) Ring finger domain
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam05484 ) LRV protein FeS4 cluster
  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam03854 ) P-11 zinc finger

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007303405.002115178225629e-63zinc finger protein
SGDYLR323C4.001714826231863e-32CWC24 SGDID:S000004315, Chr XI
I from 778952-778173, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2656.0.g41(coding)
ATGTTCAAGAAGAGAGACAAAAATCAAAATTAACTCAAAAGAACAGTAGAAGATAGAGTT
TATAACGATTAGGAAGATTAAAAGAATAGTAATAATCACTCTAAAAGATAGAAATTAGAA
GACGATTTAGACTAAATTAATTGCTAGGATCATATTCACGAGGAGAGTGGTTGCAATCAC
AATCATGATAATAATCAAATTGAATAAAAGCAATCTTAATCTAAATCTATTTCAAAAGTT
TCACATAATTCAGGAGCAAATGGAAAGCCAAAGGTTCTCTCAACATCTACTAAAACTTAG
CAAGGCTATAGGCAGTCGTTTATACATCAGGAAGTAAATGACTTAAACTTCAAGCCCTTG
AAAGAATAACTACAAAACAAAGAGTAGGATGGAGCTACGAGGTCACTAGACATCGATACT
GAGTACAGTCTAGACGCTATTGCCTTGGCTCGTAAAAACATAGAAATTACTTAGGGAATC
ATGGATGGTAAGCTGAAGCAAGGCATCTATCGAGGAGAAGCTGGGTACATGAATTAATTC
AATTTGAGTGAGACTGACCTCAAGCATAAGCAATTCACGGGTACCTTAGGACCTGTACGT
GCCCCTACTTTTATAAGAAATACCACAAGAGTCGATTATAACCCAGAGCTTTGTAAGGAC
TTCTTTGAAACAGGTCGCTGTGGCTTCGGGGACTCATGCATCTTTATACATGATCGTAGT
GATTACAAACCAGGCTGGTTGCTAGACTAGGAGTTTGAGAAGGAGTAAAAACGTAAGCAG
AAATAGATGTTAGGTCAAGATGTTAGCGATGATGAGGAAAATTATGAGATACTGTCAGAA
AATTCTCAAGGTGATGTGGACGAAGAAGGACTGCCAATAAAATGCCGAATTTGTGATTAA
TTCTTCAGATCTCCAGTTGTTACTCAATGCAATCACTACTTCTGTGAGAAGTGCGCTTTG
GATCACTATTCTAAGACTTCTGACTGCTTTATATGCGATAAGCCAACAAATGGCATCTTT
AACGAGGCTCCAAAGCTTTTGAAAAAGAGCAATTAGCTGATCAAGAAGACTCAATTTTAA
AATGAAAGTGATAATGAGGATGGTGAAAAAGATAACGAGAATAGCGATGAGGATAAAATC
AAGAAAGAAAATGATAATGATAGTGATGAAGATAATACTACTGTGACTTAACTGAAAACA
AGGCGTCCTGTAAATAACGATGACTCTGATGATGAAAATGGTGGTGTACTATCCAAGGAG
GATAGGGAAGTATTCAACTAGTATAAAAAGAAATTCGTAGATATAGATAAGAAAAAATAT
CAATCACAAACTGGCTGGTTCATCCCTTGA


>Contig2656.0.g41(protein)
MFKKRDKNQNQLKRTVEDRVYNDQEDQKNSNNHSKRQKLEDDLDQINCQDHIHEESGCNH
NHDNNQIEQKQSQSKSISKVSHNSGANGKPKVLSTSTKTQQGYRQSFIHQEVNDLNFKPL
KEQLQNKEQDGATRSLDIDTEYSLDAIALARKNIEITQGIMDGKLKQGIYRGEAGYMNQF
NLSETDLKHKQFTGTLGPVRAPTFIRNTTRVDYNPELCKDFFETGRCGFGDSCIFIHDRS
DYKPGWLLDQEFEKEQKRKQKQMLGQDVSDDEENYEILSENSQGDVDEEGLPIKCRICDQ
FFRSPVVTQCNHYFCEKCALDHYSKTSDCFICDKPTNGIFNEAPKLLKKSNQLIKKTQFQ
NESDNEDGEKDNENSDEDKIKKENDNDSDEDNTTVTQLKTRRPVNNDDSDDENGGVLSKE
DREVFNQYKKKFVDIDKKKYQSQTGWFIP