Identifiers and Description

Gene Model Identifier

Contig952.1.g15

Standard Name

RNF10

Aliases

Contig952_1_g15

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13639 ) Ring finger domain
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam12906 ) RING-variant domain
  • ( pfam11793 ) FANCL C-terminal domain
  • ( pfam03854 ) P-11 zinc finger
  • ( pfam00654 ) Voltage gated chloride channel
  • ( pfam08285 ) Dolichol-phosphate mannosyltransferase subunit 3 (DPM3)
  • ( pfam02758 ) PAAD/DAPIN/Pyrin domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005769600.00000000009998509410508463RING finger protein
SGDYHL010C0.0000008998839737394744ETP1 SGDID:S000001002, Chr VII
I from 83721-81964, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig952.1.g15(coding)
ATGTTGGTAGATTTATCCAGATAGGGTAGAGTCTAAGTGATCCAATAGGCCGAGGAATTC
AAGCAAGGCCTGTAAAATTACAGAACCTAACATAGACAAATTACTCAATAAAATAGAGAA
GCTCAATAGTAGGAAGAGATACAATAAGAAGAGGAGCTTAAAAATGATGGAATTAATAAA
GAATAAATCAAATTCTAGCCTTCTATTAATAATAATCGATAAACTACTGATATTCCTGAT
TATGATATTTATCATGAGCATATTGATGAAAATAATGAAATTCTGGAGGAGGGTTAATAA
AATCAATAAGAAAATTAGCCACTTTCAGATTAGGAAAGAATCCGATTGGCTGCTGAAAAT
AGGTAGAGAAGAGGCATCCCAGAAGGAGCAAGTGAAATGACTGTCGAAGAAAAACGATAA
GAAATTTGGAGGTTATTTTTCTGCATTATTTTCGATATTATTGGAATTGTTGTTTCATTT
AACATTGAGCTTGTGAATAAGGAAGAATGCAATATGCCTATAAAATTTTGGTTTATAATT
TATGGGTCTCTAAGCGCTATTTCTGTGCTATTTTATGTATGTTTAATAAGGGAACTTTCC
AAAAGTTACATAACAAAAGGCTCTTAAACTTTCTCTTTCATTATTGATTTATCTCTGCTA
GTATGTATGATTATAGGCCACATACTTTTATATCACCCAAAAAGCACATGCAAAGGATAG
CAACAGCAACGCCTACTCTCTGACGTTGTGTTAATTTCATATCTCAGGTTGATTCAGATG
ATATTCCTGTGCTTAATCATAATAATATGCTGTCCCATACTTTTGCTGTGTGGTGGCTTT
AGAAGAAATGCACCTGTAGCTGCTGATGGGTAAATAATCAAAAACTTGAATAAACTGTCA
TTTGATGAATTCAAGGCGTTTAAGAAATTCTTAAGAGCTCAGAAGTAAAAATCTTTAAAC
TAGGCATCACCTGGCAATATTATAAGTCAAATTTTGTCTAATTCTAGTACTACTTCTATC
GATCAATAACCACTCCTTGAAAAGAATCAAGATTAGTAAGAGAGTTAAAGAGTAGTTCAA
CCAGATAACCCCTATCTGAATAAAACGACCACCGATAATGATGAATCTGATCTCACTTGT
GCTATTTGTCTAGATGAATTCGATACTGACATGCAAGTTGTACCACTTCCCTGCAAAAAT
CACTCATTCCACATAAATTGCATAGAAATGTGGTTGAAAAAGAACTCAATTTGCCCAGTT
TGCAGGTTCCAAGTGACCAAAGATAACCTAAAAGAACTCAAAAAAGACATTGCAACTGCC
CAAAAAGCTATTAAAGAACAGTAATAATAAATGCAATAGTGA


>Contig952.1.g15(protein)
MLVDLSRQGRVQVIQQAEEFKQGLQNYRTQHRQITQQNREAQQQEEIQQEEELKNDGINK
EQIKFQPSINNNRQTTDIPDYDIYHEHIDENNEILEEGQQNQQENQPLSDQERIRLAAEN
RQRRGIPEGASEMTVEEKRQEIWRLFFCIIFDIIGIVVSFNIELVNKEECNMPIKFWFII
YGSLSAISVLFYVCLIRELSKSYITKGSQTFSFIIDLSLLVCMIIGHILLYHPKSTCKGQ
QQQRLLSDVVLISYLRLIQMIFLCLIIIICCPILLLCGGFRRNAPVAADGQIIKNLNKLS
FDEFKAFKKFLRAQKQKSLNQASPGNIISQILSNSSTTSIDQQPLLEKNQDQQESQRVVQ
PDNPYLNKTTTDNDESDLTCAICLDEFDTDMQVVPLPCKNHSFHINCIEMWLKKNSICPV
CRFQVTKDNLKELKKDIATAQKAIKEQQQQMQQ