Identifiers and Description

Gene Model Identifier

Contig1369.1.g35

Standard Name

RNF1

Aliases

Contig1369_1_g35

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010207300.00000000000007997998332353294zinc finger protein
SGDYPR093C0.0004000184047659232ASR1 SGDID:S000006297, Chr XVI
from 720424-719558, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1369.1.g35(coding)
ATGAGTGCAAATAATCATCATCACCACCATCACCATCAACATAATCCTGGCGAGATAGGA
CAGAACATTATGAACAATCACAATTAGAACAAACGCATCGTGGGAGAGCAGCAGAACTTC
CTCGTCAATGGACACAACAACAAACTTTTCATCTAGGCTCGTGTCTACAATTTGAATCTT
AATGGTCACAACAATAAAACTTTCTATAATAGTCAACAAGCCAATGCTCCACAAGAGCCA
AACTTTATTCCCAGGGTCCACAATCTGATGGTGAGTGGACACAACAACATTACTCAGAAT
TTGAAAGTAGACAACCTGACGGTGACAGGTCACAACAACAAATTCTAGAATTTACAAATC
GTAAACATCAACAACAAGGGCATCAACAACACTTTCCAGAATTGCCAGATTGGTAATCAA
CAGCAACAGCAGTAAAATTAGCCTCATCATTAACACTAACCTGGTAATGGTGGAAGAGAT
GTTCAGATGGAAGATGATGATAGCGATGATGACGACGATGATCAAGATGATTCAGACAGC
GATCATGATGATGATTCATCAGATAACGATGATGAAGATGACGATGGTAACTAAGGCGAT
GCAGAAGAGTTGAAGCAGTATGAGATTGACTAAAGAAGGTAGAATCAAAATAGGCAAAAT
CAAGCACATGGTTCTCAACCCTAACATCATCAGCCTTAAAACCATCCTCATAATTAACAT
GCAGCAAATGGCCACAGAGCAGCTAGAGTTCACCAAAATGCCACCACTCATAATTAGTAG
CACGTTCATCATCACCATCAACAGTCTCGTCCATCTGAAGCTCACTCGTAACATAGCACA
GCTAGTAGTTAACATCAACCTCAAAACCACAGAACCTAAACTAATTAACAGTAACATCAC
CACCATCACGGACTCAACCATGGACATCATCACCATCACCAAAGTCAGCAGCAACAATAA
AATCCCTTCGCTTTTGTTAACAATATGCCAAGTATCCCAGGGATGGATCCCTCTATCATG
AGTTTGTTAAACAATTTGCCAAACATGCTTGGCAACATAAGTTAACCAGGAGCTCAACCA
GGGGTTTTCAACATTGGCCCTAACATTCAGATGAACTTTATGGGAGCTAACAACGGACAA
AATTATCAAAGCCCATCAGGAGGCACCAACTTCACATTTAGCAATTACCACTAAGATGAC
TAGAATGAAGAGGACTTCGAAGACGACTAAGAAGAATACGGAGCTCAGCAGCAACAACAA
CAGCAATACTACGATGATGAAGATGAGGAGCCCAAGATGTCCGAGGAAGAAATCAGAGCC
ATCATAAACTCCTACCAGTCATTTAAGTATGAACCTGAAGAAGGCACTGAGTCAGTCAAC
TGTGCAGTCTGCATTGATGTCCTGAAGGTGGGCAGCATGGCCAAGGGTTTGCAATGCGGC
CACAAGTTTCATCCCAAATGCATCAACGACTGGCTCAAAATCAAATTGCAATGCCCTCTC
TGCAAGAAGGACGTCACTGTTTGA


>Contig1369.1.g35(protein)
MSANNHHHHHHHQHNPGEIGQNIMNNHNQNKRIVGEQQNFLVNGHNNKLFIQARVYNLNL
NGHNNKTFYNSQQANAPQEPNFIPRVHNLMVSGHNNITQNLKVDNLTVTGHNNKFQNLQI
VNINNKGINNTFQNCQIGNQQQQQQNQPHHQHQPGNGGRDVQMEDDDSDDDDDDQDDSDS
DHDDDSSDNDDEDDDGNQGDAEELKQYEIDQRRQNQNRQNQAHGSQPQHHQPQNHPHNQH
AANGHRAARVHQNATTHNQQHVHHHHQQSRPSEAHSQHSTASSQHQPQNHRTQTNQQQHH
HHHGLNHGHHHHHQSQQQQQNPFAFVNNMPSIPGMDPSIMSLLNNLPNMLGNISQPGAQP
GVFNIGPNIQMNFMGANNGQNYQSPSGGTNFTFSNYHQDDQNEEDFEDDQEEYGAQQQQQ
QQYYDDEDEEPKMSEEEIRAIINSYQSFKYEPEEGTESVNCAVCIDVLKVGSMAKGLQCG
HKFHPKCINDWLKIKLQCPLCKKDVTV