Identifiers and Description

Gene Model Identifier

Contig11125.0.g68

Standard Name

RLP24

Aliases

Contig11125_0_g68

Description

Ribosomal protein L24e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam01246 ) Ribosomal protein L24e
  • ( pfam06467 ) MYM-type Zinc finger with FCS sequence motif
  • ( pfam03008 ) Archaea bacterial proteins of unknown function
  • ( pfam04945 ) YHS domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005580702.0007467515522948e-59Ribosomal protein L24e contain
ing protein
SGDYLR009W1.9990449803848145e-49RLP24 SGDID:S000003999, Chr XI
I from 166537-167136, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11125.0.g68(coding)
ATGAGAATTGATATATGCTACTTCTGCTCAGCCAAGGTCTACCCTGGTCATGGTGTCATG
TTCGTGAGAAACGATTCAAAGACTTTCAGATTCTGCTCGTCAAAATGCAATAGACTATTC
AAGGCAAAGAAGAACCCCAGAAAGTTGAGATGGACCAAGGCTTACCGTGCTGCCCACGGT
AAGGAGATGACTGTTGACTCAGTTCTTGAATTCGAGCAAAGAAGAAATGTTCCAACCAGA
TATAACAGAGACTTGATGGTGAAGACTATTTAGGCAATGAAGAAAATCGATGAAATCAAG
GCACGCAGACAAGAGAGATTCTTCGCTCGTAGAATGGCCAAGGCAGCTGCCAAGAAGAAA
CAAGACATTGAGAATGAGCTACTTACTCACAGCGATTTAATCAATGACTCCAAAGTTAAG
AAATATATCGAGAAGAAGAAGGAAGAGAAGAGATTAAAGCAATTAGCTAAATATCAGGAA
CAAGCTAACAGAAGCAAAGGCATGGGCAAGGACATCGATATGTTGGAGGAAAGCGAAGAC
GAAAAGATGGAGATCGTAGAAAAAATTAAAACCAAGAAGTCAGCTAAAAAGACCAAGGCC
ATCAAGAAGAAGGTATGA


>Contig11125.0.g68(protein)
MRIDICYFCSAKVYPGHGVMFVRNDSKTFRFCSSKCNRLFKAKKNPRKLRWTKAYRAAHG
KEMTVDSVLEFEQRRNVPTRYNRDLMVKTIQAMKKIDEIKARRQERFFARRMAKAAAKKK
QDIENELLTHSDLINDSKVKKYIEKKKEEKRLKQLAKYQEQANRSKGMGKDIDMLEESED
EKMEIVEKIKTKKSAKKTKAIKKKV