Identifiers and Description

Gene Model Identifier

Contig11086.0.g6

Standard Name

RIP1

Aliases

Contig11086_0_g6

Description

Replication initiator protein A (RepA) N-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam06970 ) Replication initiator protein A (RepA) N-terminus
  • ( pfam00645 ) Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region
  • ( pfam11068 ) Protein of unknown function (DUF2869)
  • ( pfam11176 ) Protein of unknown function (DUF2962)
  • ( pfam11842 ) Domain of unknown function (DUF3362)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11086.0.g6(coding)
ATGTTTTAAAATCCAGAGGACAATAGCACAAGATAAGTAGCATTGACTGCAAAATATATA
GGTGCAGGAGGAAACTTTCATTAGCTATAGTCAGGGCATTATGCAATCTTGGACACTCCT
GCCCCTGTGAACAGAGACATGAGGTTCAGTCATCCAACTGCATTTACTACAACTAAATAT
CTAATCAATGATGAATTTTCAGAATTACTTGGCTTAAGTGAGCCAGTAACTAGAAAGCAA
GTGCAGACAGCTTTTATTAATTATGCAATAAATCATGATTTTGTGGACTTAAAGAGTCAT
CACTATTTGATCTATAGAAATGCAAGGTTAAAATCTATGCTTGGAGCAGATACAATTCAT
CCCAAAAACCTCTTCAAATATCTCAGAAAGATGTTAGTACCAATCTAGAGACCTTTAACA
GATGCTGATGTTGAGAAAATCAGAATTAAGAGTTAAATGAAGCGAGCTGAGAATAGAATG
AGAAAACAAACTTAAAATTTCCAGCCTCAGCAGTAGTAGCAGCAGTAAAATTATCACAAG
CCTAAGTATGCTCATGGCAGTTGTATTAGTGAACTATAGATGGAGCTTAAGAAAGAAGTT
GAGCAGGCAGAAATTGAAGGAGGACTAAATGGCACTATCAAACTTGACTTAAATCCAAAC
TTTAACAATGATAACAGCTAAAGTAGCTAGAGTAGCAGGAAAAGTAGAGGTGGAAGAAAT
AGCTAAAACCTTTCATAGAGTTCGAATCCCTTGTCATGTATGGCAGGAGCTGGTAAAGGA
AGCAAAACTGAGAAAAAGAATTAAGCAAACTAAAACTTTAATGAAGGAATCTCAATAGAT
GATTTAATTAATGGGGAGAATTTAGATGAGGATTACTCAGCTTTATTTAAAAGATGA


>Contig11086.0.g6(protein)
MFQNPEDNSTRQVALTAKYIGAGGNFHQLQSGHYAILDTPAPVNRDMRFSHPTAFTTTKY
LINDEFSELLGLSEPVTRKQVQTAFINYAINHDFVDLKSHHYLIYRNARLKSMLGADTIH
PKNLFKYLRKMLVPIQRPLTDADVEKIRIKSQMKRAENRMRKQTQNFQPQQQQQQQNYHK
PKYAHGSCISELQMELKKEVEQAEIEGGLNGTIKLDLNPNFNNDNSQSSQSSRKSRGGRN
SQNLSQSSNPLSCMAGAGKGSKTEKKNQANQNFNEGISIDDLINGENLDEDYSALFKR