Identifiers and Description

Gene Model Identifier

Contig2742.0.0.g100

Standard Name

RIM13f

Aliases

Contig2742_0_0_g100

Description

Calpain family cysteine protease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00648 ) Calpain family cysteine protease

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001966502.9993743585281133e-40Calpain family cysteine protea
se containing p...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2742.0.0.g100(coding)
ATGAAAAGAAATTTTCAATCAATAATTACTAGATTGAAGACAAAGGTTGACTACAGTGCT
TTAATTAAAAAAGGTGCAGTTTGGAAAGACCCCAGTTTCAGTTATAGCGATGATGCCTTT
TATTTCCCGAAATATACCAATTAAGGACAACCATTTTAAAATCCTAGCACTTACCAAATT
GATAGACCAAAAAACAGAAATGCAAAACTTTCACTTTTTGGCAACTAAAAACAGCCAGGG
CCTTTGGATATTCGACAAGGTCAGCTTGGAGATTGTTATTTTTTAGCTTCTTGTTCTGCC
ATTACTGAGTATCAGCAGAGAGTAATGAACGCATTTGTAACTTAAGAATTCAATTCAGCT
GGTGTTATTGTTGTCAGAGGATATATTCTAGGGCAACCCACTGATATAGTAGTTGATGAT
ACACTCGCTTTCAGCACATCTGCAACTTCCAAGGGGGAACTACTTTATGATATGGCTCCA
TCTTCAAATGGTCTATGGGCAGCATACCTCGAAAAGGTGTGGGCCAAGGTCATGGGTAAT
TTTGAAGTCATAGAAGGTGGCTGGTCAGAAGAAGTAATGCAATTTTTAACTGGAGCTCCC
ACTTTAACATACGTGAAAGATTATAGTGGATTCACAAGTGCTGACGATGTATGGAATGTA
ATTTCTAATTCAGACAATGCTAGGTATATTATTATGGCTGGTACTCCTGGTTAGGGCAAT
GATCAAGATATTTTACCTAATGGTCTCGCAAAAAGTCATGCTTACACTTTATTAGAAGCA
TACATTCTGAGAGAATAAAATGGCACTGCTAAAGCAAGATTATTTAAAATGAGAAATCCA
TGGGGCAAAGATGGAAAATACAAAGGTTAATACTATGATAGTGACCCTATTTGGACTCAA
GGAGACTACGCATCTTAGGTTGGATTTTAAAAAGCAGACGATGGTTTATTTTTCATAACC
GCTGAGGAGTTCTACGATAGTTTTGATGCGTACAGCATAGCATTTTATTCTGATTCCTAT
CAGATTTCTGCAAACACGGTTTATGGTGATAACGGAAAAGGCTATAAATTTGACTTTAGT
TTGCCTAGTGATGCTGAGGGCTACATGGGGATAGATTACTACAGTAGTCGAATGTACCCC
CCTGGCTGATGA


>Contig2742.0.0.g100(protein)
MKRNFQSIITRLKTKVDYSALIKKGAVWKDPSFSYSDDAFYFPKYTNQGQPFQNPSTYQI
DRPKNRNAKLSLFGNQKQPGPLDIRQGQLGDCYFLASCSAITEYQQRVMNAFVTQEFNSA
GVIVVRGYILGQPTDIVVDDTLAFSTSATSKGELLYDMAPSSNGLWAAYLEKVWAKVMGN
FEVIEGGWSEEVMQFLTGAPTLTYVKDYSGFTSADDVWNVISNSDNARYIIMAGTPGQGN
DQDILPNGLAKSHAYTLLEAYILREQNGTAKARLFKMRNPWGKDGKYKGQYYDSDPIWTQ
GDYASQVGFQKADDGLFFITAEEFYDSFDAYSIAFYSDSYQISANTVYGDNGKGYKFDFS
LPSDAEGYMGIDYYSSRMYPPGX