Identifiers and Description

Gene Model Identifier

Contig1459.0.g19

Standard Name

RIM13e

Aliases

Contig1459_0_g19

Description

Calpain family cysteine protease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

  • calcium-dependent cysteine-type endopeptidase activity (IEA) | GO:0004198

Biological Process

Domains

  • ( pfam00648 ) Calpain family cysteine protease

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001966509.997441244797434e-45Calpain family cysteine protea
se containing p...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1459.0.g19(coding)
ATGAGATCTATAGCTGCTCTCCTTCTCTTGGCAACTGCGACCCACGGGTTAAGTGTCAAC
CAAAATCGCAACAATGTTAGTTCAAAGCTTTATCAACTTTCTAACAATCTTTCAAGAGCT
TAGTAAACAAACAATGGCTAATAATGCGATACTATTATCAAGAGATTCAAGAGCAGCAAT
ATCGATTACAACTCTATCATTGGTTCTGGTAAGCAATTCACAGACACAGAATTTTCCTTC
GCAAATGATGCTGTTTACTGGCCACAATACAATTAGAACTACGCCAAGGAGTTGTGGTAT
GATAAGTACGAAGTGTTCAGAGCAAGAGAGAAGCTTCCTACTGCTACTCTTTGGGGTAAT
TAATCCATGCCAGGACCTAATGATATCGAGTAAGGATATATTGGAGATTGCTATTTAATG
GCGGGTTGCGCTGCAATCGCCGAAAATGGTGACAGAGTCAAGAAAATCTTTGTAACTCAG
ACTTATAATAAAGAAGGAATCATAGTTGTGAAACCAACCATATTGGGCAACAATAAAGAA
GTTGTTGTCGACGATTACCTCGCTTTCTTTAAGAAAACCACTGGACTTAAAGGTCTTACT
TTTGATCATGTTTCGGAAAGAGATGGTCTCTGGGGACCATTCCTTGAAAAGGCATTTGCT
AAAGCACATGGCAACTTCGATCAAATTAAGAGCGGATCAGGTAGAGAGGTCTTCACATTC
ATGTTTGGCATCCCATCTACCAAAATTTCCAATGGTAAGGAAGGCTGGATCAATCCAGAG
CAAATCTTTGACACCATCACAAAAGCTGATCAGGCCTAATACATAATGTGGAGTGGAGTC
CCAGGTGGCGGAAATGATCAAGTTCAGCAAAAGTACGGCTTAGCAATGAGTCATGCATAC
ACAGTGATCGGTACTTATGTTGTTAACTATGCCAATGGCACTGAAGCAGCCAAGCTCCTT
AGAATCAGAAACCCATGGGGTAGCGATGGAAAATACAACGGAACATGGTGCGATAAGAGC
GAAAAATGGACTGATGAAGTCAACAAGTTCTACAGTTAAGTCCCCTTCGTTAAGGACTAA
GAAGACGGTGTCTACTTCGTAGACTTGTAAACCTATCACGAGAGCTTCGACCAAATTATC
ATTGGTTTCTGGGATGACTCGTACAGCAGCTCCACCTCAACCATATACGGTGATGCTGGC
TTTGGGTCCAAATTTGAATTCACTCTTTCAGAGCTTACTGATGGATTTTTAGGTCTAGAC
TTCTACAGTCCAAGAATGTATCCACCTGGTTGCCGTGACACTTCAAGCAGCGCTTTGATG
AAAGTTTACATGGACGGTATTCTTGTTAATTCTCAGACAATCAGAGACTCTGACTACTAC
GGATTTATCAGAAACAAGTGGCTTCCAGGCACTTACACTGTTGTTGTTTCACAAAACAAA
TGGGGAGTCAATGACGTCAGAGACTTCAGTTTTAGAGCTTTCCTCCCAGTCAAGGTGAAC
ATTCAATCTTACAACTACAAATCCCAACAAGAATTTGCTGAGTTCACAAACAAACTTGAC
TTCAAGAGCGTCTAATCTCAAGCTCTTACTCCTATAAATGATCCCTCCGGAGTCACCATC
AAGAAGAGCTGGTCATCTCTTAACAATTATTTCTACTCAGCTTAAGGTGTTGTTGGAAAA
CAATGCACTATAAGTCTCAAGATGAAAATCTTAGATGCAGACGCTTATTTGATAACTGAG
TAACCAACCTCAAGTTTCTCAAAGTCAAACTATTAAACCACTGTTGTGGCAACTGGACTT
CAGAGAAATGATACTGAGTTCACTGTTGCTTGCACTACAACTGGTAACTAACAATGCAAT
TGGATGATGGTCCCCATTCCTCCACTTGGAAACATTCAAGCTAGTATTGGACCTGCTACA
TTTAAATGTATTTGA


>Contig1459.0.g19(protein)
MRSIAALLLLATATHGLSVNQNRNNVSSKLYQLSNNLSRAQQTNNGQQCDTIIKRFKSSN
IDYNSIIGSGKQFTDTEFSFANDAVYWPQYNQNYAKELWYDKYEVFRAREKLPTATLWGN
QSMPGPNDIEQGYIGDCYLMAGCAAIAENGDRVKKIFVTQTYNKEGIIVVKPTILGNNKE
VVVDDYLAFFKKTTGLKGLTFDHVSERDGLWGPFLEKAFAKAHGNFDQIKSGSGREVFTF
MFGIPSTKISNGKEGWINPEQIFDTITKADQAQYIMWSGVPGGGNDQVQQKYGLAMSHAY
TVIGTYVVNYANGTEAAKLLRIRNPWGSDGKYNGTWCDKSEKWTDEVNKFYSQVPFVKDQ
EDGVYFVDLQTYHESFDQIIIGFWDDSYSSSTSTIYGDAGFGSKFEFTLSELTDGFLGLD
FYSPRMYPPGCRDTSSSALMKVYMDGILVNSQTIRDSDYYGFIRNKWLPGTYTVVVSQNK
WGVNDVRDFSFRAFLPVKVNIQSYNYKSQQEFAEFTNKLDFKSVQSQALTPINDPSGVTI
KKSWSSLNNYFYSAQGVVGKQCTISLKMKILDADAYLITEQPTSSFSKSNYQTTVVATGL
QRNDTEFTVACTTTGNQQCNWMMVPIPPLGNIQASIGPATFKCI