Identifiers and Description

Gene Model Identifier

Contig8467.0.g65

Standard Name

RIM13d

Aliases

Contig8467_0_g65

Description

Calpain family cysteine protease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

  • calcium-dependent cysteine-type endopeptidase activity (IEA) | GO:0004198

Biological Process

Domains

  • ( pfam00648 ) Calpain family cysteine protease
  • ( pfam01067 ) Calpain large subunit, domain III
  • ( pfam04212 ) MIT (microtubule interacting and transport) domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011086106.001249495680822e-29Calpain family cysteine protea
se containing p...
SGDYMR154C0.000000000500206551404915RIM13 SGDID:S000004763, Chr XI
II from 568182-565999, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8467.0.g65(coding)
ATGGAATCCAGAGGAAGTTTCCCCCACAGCATTGGGGGAGGAGCAGGTTTTAATAACAAT
TTCGGCTCTTTCAACCAGGGTGACTAAATAGTCTACAATCTAGGATTGGAGTACCTGAAG
TCAGCCAAGAGATTCGAGTAGAATGGGGATATAGAGCAATCCTACAAATTCTACAGGGAG
GCAGCTAATAAATTCCTATATCTAATTAAAAATGAGGCACAGAGATCCACACAATAAGAG
AAGGAGCTGAAAGAATTGACTTAAAATGCAATCGACAATGGTTTATACATGAAAACTCTA
GTTGATGACAAAAAACAGTAATAACTAAGTAATGGAAGGTAAAGGTCTTAAAATCAGTAA
GTAATTGGGTTAAGACTCTGTGGTAACAATTACATGGAGGCTTATAACTTCTACATGAAT
CTAGGAGAGTACTACTTCCAGTTAGTCACCAGAAGCAAAGGCTTATTACCTACCAGTAGA
GCATGCTACTACAATGCAGCTTAAAATCTCAATGCAATCAACTAAATCGTGAAAGATGAC
AGTCAGAAATTAACAAATAAGAAAAAGCTGTCAGATTTACTCACACTCATTGAGGGAATG
GACTAGAAAATCAAATCTGACATATAATTTGATGCCAAATCCAATGCTCTATCTCAATAT
GATGCCAAGGAACGATAGATTATTGAAGCTGGGTCTTTGGTAAGAGGGGGAAACTTTGAA
ATATGGTCTCCTGAAAAGGGCATTATCAATATATTCTCATCTGAAGCATTTGAAGACAAA
GATGGACTGCTAAAGTTGTCTTGTAAATAACTCAATAATTTTGGATAATGGGTTAGGCCC
ATAGAAGTAATCGATAGGAAACATTACATTAATGGAAGGCCTGATGTAGCAACAGGAATC
ACTGGCTTTGAAATTATGTAAAGGAAAATAGGAGATTGCTCAGTTTTATCATCTCTAGCT
GTAGCTGCTCATTATGAACTTAAAATGAAATACTCTAAAAGATTAGTATCATGCTTGATA
TTTCCTCAAGACAAGAATCAATACCCGATATACAACCCTAGTGGAAAATATGTCGTAAAG
TTATTCATAAATGGCATTTGGAGAGCAGTAGAAGTTGATGATTATTTACCAGTTGATAAA
AATGGTAACTTTGTCTGTGCTTACTCAAACAAGGGTAAGCTCTGGGTTAGTCTTATAGAA
AAGGCTTATCTCAAAGTTCATGGTGGCTATGAATTTATTGGAAGCAACTCTTCAAGAGAT
CTATACACATTGACAGGATGGCTACCAGAAAAAATAGACTTGAAATCCTATAACAAGCAG
AGACTCTGGGAAAGAATTATGAATGGCTATAGAGCAAACGATTGCTTGATAACAATAGGC
ACAGGATTGATAATAGATGAAGATGCTATTGGTTTGGTAAGCAATCATGCTTATGGAGTA
CTAGAAATTTATGAAATCAATACTCATAAGATTTTGTTGGTCAAAAATCCATGGGGTCAT
TTCAGATGGAACGGCAGATTTTCAACTGAGGATAGAGTGAGCTGGACTGCTGAACTGAAA
TCAAAATTGCACTATGAGGATCTTGCTGCATCTGATAATGGAATATTTTGGATAGATTTT
GACTCAGTATGCGAATATTTTGAGAGTTTAGATATTAACTGGAACCCTGAGCTTTTAGTC
TACAGAAAGAGTTTCTTTGATTTATGGAAATCGTCAGAAATGTCACATACTTAATCCTTC
TCAATCAAAGATAATCCTCAATATTGCATAAGATATGTAGAAGATAAGGATTTGAAATTC
TAGTTTGACACCATCATTACATGGGTAACCATTTCAAAAATGCTCATTATTTAAAATGGA
GAAAATGAAGATGAGGAAAAAGCAAGTGATTATATCGCTATGCATGCCTATCCAAACCCA
TCAGGCTGCATTAAAATATTGGAGGATAGAAATGCAATTGTTAAATCAGTTTATACAAAT
GAGCAAAATTACATGCTGTATTTGCAGTTTCCAGCTTCAGAATACTACAATCAATAAAAG
GTTTTAAACCTAGTTCTAGACTAGCATGAAAGACACAAAGACCTTTACTATAACATTAGA
GTCGTCTCTAATTGTAACTTTGTCACATAGAGGGCTTAATTTAACAACCTCAAATAAATT
CAAAGATTTGAAATACCCAATAAACCAGGTGGTGGAGTACCTACTTCTCCCATGTTTTAT
ACATCTCCACAGTTTTACTTCACTCTTGATACTTCAAAATGTCCTAATCCTGGCTCAATT
GATACAGTTGAAACTTTAATTACTTTTAAGTCTTCTAGTAACTCGGACGTTAAACTTTTT
TTGGTAAATGCAGACTCTAAGGAGAGAGTAAATACTATTAAAGAAAGCTAATTAGTAGAT
GCAACTTTAAAATTTTCTTATTATAAGCCTTCAACAGTACATCTCCATTATAGATTAGCA
AAAGGGCAATATTATACAGCTGTTGTTTCTACATTCAAATAGGAGCAGTCAGCATCCGGA
TAATTAACTTTCGAAAGTGATCACCCATATTAAATAAGAGAACTTCCTTAAGAAGGGTTA
GGTATGAAAAAGACAGTAATTGATGGAGTTTGGTTTCCTGAAAACGCTGGTGGTTGTGGT
AACTTTGGAATGTTTGATAAAAATCCAGCTTATGCATTTAATCTCTCAGATGAAGCTGAT
GTTCAAATTAGATTAAGAGTTCTTGAGGAAGTTGGGCCTGATGGATTCTCATCTATCTCA
GATTTTGAAAAGTTTTAGTATTGTGTAAGTCTAATGGCGTACAGAGTTCAAGCAAATAGA
TGGCCTGTTCCTGTAGGATCAATTCAAATAAAATCTCTATCTAACCCAGCATTAGTCACT
AATAATGGAAAGTATACTAATAACTTGTCATCTTGTGTTTCAAAAAAAGAGAAACTCGCA
AAGGGTGTATACCTTATTATCCCATCAACTTTTAATCCACAACAAGTTGGAAAGTTTGAA
ATTACTATTTATTCATCAATCAATATCGAAAGCTCTAAATATCAATGA


>Contig8467.0.g65(protein)
MESRGSFPHSIGGGAGFNNNFGSFNQGDQIVYNLGLEYLKSAKRFEQNGDIEQSYKFYRE
AANKFLYLIKNEAQRSTQQEKELKELTQNAIDNGLYMKTLVDDKKQQQLSNGRQRSQNQQ
VIGLRLCGNNYMEAYNFYMNLGEYYFQLVTRSKGLLPTSRACYYNAAQNLNAINQIVKDD
SQKLTNKKKLSDLLTLIEGMDQKIKSDIQFDAKSNALSQYDAKERQIIEAGSLVRGGNFE
IWSPEKGIINIFSSEAFEDKDGLLKLSCKQLNNFGQWVRPIEVIDRKHYINGRPDVATGI
TGFEIMQRKIGDCSVLSSLAVAAHYELKMKYSKRLVSCLIFPQDKNQYPIYNPSGKYVVK
LFINGIWRAVEVDDYLPVDKNGNFVCAYSNKGKLWVSLIEKAYLKVHGGYEFIGSNSSRD
LYTLTGWLPEKIDLKSYNKQRLWERIMNGYRANDCLITIGTGLIIDEDAIGLVSNHAYGV
LEIYEINTHKILLVKNPWGHFRWNGRFSTEDRVSWTAELKSKLHYEDLAASDNGIFWIDF
DSVCEYFESLDINWNPELLVYRKSFFDLWKSSEMSHTQSFSIKDNPQYCIRYVEDKDLKF
QFDTIITWVTISKMLIIQNGENEDEEKASDYIAMHAYPNPSGCIKILEDRNAIVKSVYTN
EQNYMLYLQFPASEYYNQQKVLNLVLDQHERHKDLYYNIRVVSNCNFVTQRAQFNNLKQI
QRFEIPNKPGGGVPTSPMFYTSPQFYFTLDTSKCPNPGSIDTVETLITFKSSSNSDVKLF
LVNADSKERVNTIKESQLVDATLKFSYYKPSTVHLHYRLAKGQYYTAVVSTFKQEQSASG
QLTFESDHPYQIRELPQEGLGMKKTVIDGVWFPENAGGCGNFGMFDKNPAYAFNLSDEAD
VQIRLRVLEEVGPDGFSSISDFEKFQYCVSLMAYRVQANRWPVPVGSIQIKSLSNPALVT
NNGKYTNNLSSCVSKKEKLAKGVYLIIPSTFNPQQVGKFEITIYSSINIESSKYQ