Identifiers and Description

Gene Model Identifier

Contig19810.0.g61

Standard Name

RIM13b

Aliases

Contig19810_0_g61

Description

Calpain family cysteine protease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

  • calcium-dependent cysteine-type endopeptidase activity (IEA) | GO:0004198

Biological Process

Domains

  • ( pfam00648 ) Calpain family cysteine protease

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001966505.002382393859839e-46Calpain family cysteine protea
se containing p...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19810.0.g61(coding)
ATGAGAATCCAGTTAGCAGCTCTTCTCGCTCTTATGGGCGTATCTATGGCAATTTCAAAT
AGAAATGGTAACAACAGAATGCAAAAGCTTGTTCAAGGCTTGTCTTAAAGTCAAGTTGGA
CAAACAGTTGCATTCACTCCCAGTTGTACATCCACTTTCAATAGATTCAAGAAAGCTGTT
GATTGGAAATCAATTATTTCTAGCAGCACCACATCGTGGTCTGACCCCGACTTCCCCTCT
GACGCCACAGCTCTCTACTGGAACTCATACACCACCAATGAAATGACAAGATCTACTCTC
TCCTGGAAGAGACTTAAGGATGCATATCCCAATGCTCCATACAGAGGTACCAATGTTGGA
GAGGCTGTTGCTCAAGGGTACGTTGGTGATTGCTATTACTTAGCAGGAATCGCTGCTTTA
GCCGAACTTCCTGAGAGACTCGACTATAATCTCATCACAAAGACAAAGAACGCAGCTGGT
CTAATCTCACTCAACGTTTGGGTTAGAGGTATCCAAACACAACTGGTCATTGATGACTCA
ATCCCATTCTACGGCAGTGAACCTGCTTTCGCCGACATCGGTACTGATCAGTCTCTCTGG
GGACCCATTTTCGAAAAAGCATGGGCCAAAATCAATGGAAACTATGAAATAACTAATGGC
GGTTTCCCTTCTGAAGCCTCTACATTTTTGACTGGTGTACCTTCAGCTTCTTATCAAGTT
AAAGGTGTACTCTCTGCTACTGCTCTCTGGAACATTGTCAGCCCAGCTGATGATAAAAAC
TACATTATGAGCGTCTGGACTGACTCTGGTTCAGATACCACAACTTGCGACTACAACCTT
CCATGTGGCCATGCTTACACCCTCATCAAGAAAATTGAAGCTACTCTTGCTGATGGATCT
AAGGTCAAACTTTATCAAATCAGAAACCCCTGGAGAAAGGAAACTTAAGGCGACGGTACC
AAGCCATTCAGCGGAAGCTATAAAGATACCGCAACCGTTTGGACCACTGATGCTGGCCTC
GTGAAGCAAACTGGCTTTGTTTCAAAGAATGACGGTATTGTTTGGATGACTGAATCAGAA
TTCTTGCAAGCTTTCGTGTACATGCAAATTTCTGAATGGAGAGGTTCAAACTGGGTTCAA
TCAGTTTACTCAGCTGAAGGTGCAACTACTGCTTCTCAAACTTACTACATCGATGTTCCA
GTCTCTACTCAAGCCTACATTAAGCTTGATCTCTATAACCCAAGAATGTATGCACCCAAA
TGCAGAACCGATGCTGATTTTTCAAAGGGTAAAATGTAATTATACTCACCATCAGGTGCT
CTCCTCACTACAGCCACCACTTGGGACTACTGGACATCTGGTTATATCCAATACACAGAC
TCAACCCCACTTGCCGCAGGTAAATACAAGGTTGTTGTGACCCCAACTTGGTCCACTTCA
GCTAACGAGCAAAAGGATTACACTTTGTCTGTGTATGGCTCAGGAAAGGTTACAATCACC
AACGATAAAGGTGTCACCAGCATCAAGGGATCTCACGAGCTTAACTATGGAGGATCAACC
ACACCAACAACTGCACCAACAGTCGCCCCAACAACTGTAGCACCTACCAAAGCTCCAGTT
ACTACCCCTGCTCCAGCAACAACTAAACCATCACCAGTGACCACAAAGCCTGCTCCAGTA
ACCACGAAGCCATAACCAACTACTACTAAGCCAGCTCCAGTCACCACCAAACCTGCTCCA
GTCACCACCAAGCCCGCACCAGTCACCACTAAACCTGCTCCAGTTACCACTAAGCCCGCA
CCAGTCACCACTAAACCTGCTCCAGCCACCACCAAACCAGCACCAGTTACCACCAAACCT
GCATTCACAACCAAACCAATCTCAACTGCTACTCCAGCACCCGTTACTACAAAATCTGCA
GTAACAACAGCTGCCCCAACCACTAAAGCTCCATTGACTACTAGATCATCCATTGTTAAA
CTCACAGGTGATGTAGTCAAGGATGTCACTGCTGCCAGATACTCTTCTGATCTATTCTAT
CTCGATGGTGGATTCTACTATGCCGCCAACAAGACTGAATATCTTAGCAGCACCGTTGTT
GAGAACGTTCTCTACTTCGGTACTACCAATACCGCATACGCATTCAACATGACAATTGGT
GCATATGCTGTCTAACCAACCTATGCATTCACCTAGGGTGCTGACAAGTGCAAGAGCCAA
TTACTTAGTGATGAATACGGCTACTACTACTATATTACTTGTAACTGCATTTTGAATGTC
ACTGCTCCTCAGACATTCCAAGAGTGCGGTTTAGCTGTTAAGGATTCTCAAGGATGGGTT
GCACCTTTCTACAGTAGCAATTCTATTGTATTCAAATGA


>Contig19810.0.g61(protein)
MRIQLAALLALMGVSMAISNRNGNNRMQKLVQGLSQSQVGQTVAFTPSCTSTFNRFKKAV
DWKSIISSSTTSWSDPDFPSDATALYWNSYTTNEMTRSTLSWKRLKDAYPNAPYRGTNVG
EAVAQGYVGDCYYLAGIAALAELPERLDYNLITKTKNAAGLISLNVWVRGIQTQLVIDDS
IPFYGSEPAFADIGTDQSLWGPIFEKAWAKINGNYEITNGGFPSEASTFLTGVPSASYQV
KGVLSATALWNIVSPADDKNYIMSVWTDSGSDTTTCDYNLPCGHAYTLIKKIEATLADGS
KVKLYQIRNPWRKETQGDGTKPFSGSYKDTATVWTTDAGLVKQTGFVSKNDGIVWMTESE
FLQAFVYMQISEWRGSNWVQSVYSAEGATTASQTYYIDVPVSTQAYIKLDLYNPRMYAPK
CRTDADFSKGKMQLYSPSGALLTTATTWDYWTSGYIQYTDSTPLAAGKYKVVVTPTWSTS
ANEQKDYTLSVYGSGKVTITNDKGVTSIKGSHELNYGGSTTPTTAPTVAPTTVAPTKAPV
TTPAPATTKPSPVTTKPAPVTTKPQPTTTKPAPVTTKPAPVTTKPAPVTTKPAPVTTKPA
PVTTKPAPATTKPAPVTTKPAFTTKPISTATPAPVTTKSAVTTAAPTTKAPLTTRSSIVK
LTGDVVKDVTAARYSSDLFYLDGGFYYAANKTEYLSSTVVENVLYFGTTNTAYAFNMTIG
AYAVQPTYAFTQGADKCKSQLLSDEYGYYYYITCNCILNVTAPQTFQECGLAVKDSQGWV
APFYSSNSIVFK