Identifiers and Description

Gene Model Identifier

Contig22064.0.g10

Standard Name

RFC4

Aliases

Contig22064_0_g10

Description

ATPase family associated with various cellular activities (AAA)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002451503.9999653329316734e-115ATPase, AAA family protein
SGDYJR068W6.996673098078189e-105RFC2 SGDID:S000003829, Chr X f
rom 567643-568704, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22064.0.g10(coding)
ATGGACAAATTCTTGAAAGGATCAAATCCCACTAAAAATCTAGGTTCATCTAGTGGTATT
CAGATTAACACTAGAACTAATCAAACTTAAGATCATGAGATGAAAGATCAGACTCAAAGT
GCACCATCAAGGCCAAAGTTCACTCCTTGGGTTGAGAAATATCGCCCATCAAAAGTGGAA
GAAGTTTCTCATTAAACTGAAGTCGTATCAGCTTTGAGATAGAGTATCCTTACTGGTTAA
GTACCACATTTAATGTTCTATGGCCCTCCAGGAACTGGCAAGACTTCAACAATCCTGGCT
TTATCCAAAGAACTATTTGGCCACGAATTCTTCAAGCAAAGAGTGTTAGAGCTTAATGCA
TCAGATGAGAGAGGTATCGCTATAGTCAGAGAAAAGATAAAGAAGTTTGCTCAGAGAAAA
ATCTCAAAGCACCCAGATTCAAGCTTCCAATGCCCACCTATTCAAATTATTATTCTCGAT
GAAGCCGATTCTATGACTATTGATGCTCAAGCTGCCCTTAGAAGAATCATTGAGCAATAT
TCTACAAATACCAGATTCTGCATTATTTGCAACTACATCTCCAAGATCATTGATCCTCTC
GCTTCAAGATGTGTAAAGTTCAGGTTCTCCCCTATTGCCAAGGAAGCTTAGATTGAGAGA
CTTAAGATGATTTGTGAAAGAGAAAATGTTAATGTGGCATCTGATAATGTTTTCAATGCT
TTGGTCGACATTTCAGCTGGTGACTTGAGAAGATCAATCAATACCCTCCAAACAGCTAGC
TCTTTCAAACTTCAGCAACTCAATGTTAAGGATATCGAGAGTATCAGTGGTGTAGTCCCA
GAAGATGTTATAAGAAAGATTGAGAGAGTTGTCACACAGACTGATGGCTTCTCTGAAGTG
CAGTAATTAACTCAAGAGTTGATTTTGGATGGCTTCGATGTGCAGCAATTGATGATATAA
ATGCTTGACTATTTCTTAATCAACGACAAACTCAGCGACTTGAAGAAGGCCAGAATCAGT
GAGATAGTGGCAGAAACTGATGTCAAGGTGATTCAAGGTGGCGATGAAGAACTTAACTTG
CTGTATACTCTCAGTTCAGTATCTAAAATAATTAAAGGGCAGTGA


>Contig22064.0.g10(protein)
MDKFLKGSNPTKNLGSSSGIQINTRTNQTQDHEMKDQTQSAPSRPKFTPWVEKYRPSKVE
EVSHQTEVVSALRQSILTGQVPHLMFYGPPGTGKTSTILALSKELFGHEFFKQRVLELNA
SDERGIAIVREKIKKFAQRKISKHPDSSFQCPPIQIIILDEADSMTIDAQAALRRIIEQY
STNTRFCIICNYISKIIDPLASRCVKFRFSPIAKEAQIERLKMICERENVNVASDNVFNA
LVDISAGDLRRSINTLQTASSFKLQQLNVKDIESISGVVPEDVIRKIERVVTQTDGFSEV
QQLTQELILDGFDVQQLMIQMLDYFLINDKLSDLKKARISEIVAETDVKVIQGGDEELNL
LYTLSSVSKIIKGQ