Identifiers and Description

Gene Model Identifier

Contig21432.0.g8

Standard Name

RFC3

Aliases

Contig21432_0_g8

Description

ATPase family associated with various cellular activities (AAA)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002136002.0000857274312427e-108hypothetical protein
SGDYNL290W8.003265703977305e-104RFC3 SGDID:S000005234, Chr XIV
from 86218-87240, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21432.0.g8(coding)
ATGGTTCAAAGACTACCATTCGTTGAGAAGTATAGACCTAATGACTTGGAAAGTATCATT
TCTCATGATGAAATTATTACAACTGTCAGGAGATTTATTGAAACAAGAAAGATGCCTCAC
CTTTTGTTCCATGGTCCACCAGGAACTGGAAAGACCTCATGTGTCATCGCTATTGCTAAG
CATTTGTATGGAAAAGCTGAGTATAAGAACATGATTTTGGAATTAAATGCATCAGATGAC
AGAGGTATTAATGTTGTTAGAGAGCAGATTAAAAGTTTCTGTTCTACTTAACAATTAATG
AGCAAGGGAATCAAGCTAGTTATTCTTGATGAGTGTGACTCAATGACTTCATCAGCTTAA
TTCGCTCTAAGAAGAATCGTCGAGAAGTACACTAAGACCACAAGATTCTGCTTCATTTGT
AATTATGTATCAAAGATCATTCCAGCTTTGCAATCCAGATGCACAAGATTTAGATTTGGT
CCTCTTTAAACTGAGAACATCTTGCCCAAACTTCATGAGATTGCTGAACTTGAAAACTTG
CGACTAGATCAAGACGCAGCAGAGTCTATTGTAAAGTTAAGTGGTGGTGATATGAGAAAG
GTCTTGAACGTTCTTGAAAGTTGCTCCCTAGCTCACAAGCACATCACTCTTCAAAATGTG
TATGATGTGACTGGCAGACCTTCCCCCTATGACATCGAGAATATCTACATTTCCTTAAAC
AACGATAGACTGAACGATGCTCTTAACACTATCAACTCTTTAAAACAGGTTAAGTCATTA
TCTGTTGAGGATATTATCAGTGAGATTCACAAGAAAGTTATGCAGACCAAGATGCTTGAT
GAAATGAAGATATTCTTGATTTCTCGCATGGCTGAGATTGAATATAGAATGGCTTAAGGC
AGTAGTGAGAGAGTCAATTTAGCTTCATTAGTTGGTGGATTCAATGAAGTTAGATCTGTT
AAAGCTTTAAAGTGA


>Contig21432.0.g8(protein)
MVQRLPFVEKYRPNDLESIISHDEIITTVRRFIETRKMPHLLFHGPPGTGKTSCVIAIAK
HLYGKAEYKNMILELNASDDRGINVVREQIKSFCSTQQLMSKGIKLVILDECDSMTSSAQ
FALRRIVEKYTKTTRFCFICNYVSKIIPALQSRCTRFRFGPLQTENILPKLHEIAELENL
RLDQDAAESIVKLSGGDMRKVLNVLESCSLAHKHITLQNVYDVTGRPSPYDIENIYISLN
NDRLNDALNTINSLKQVKSLSVEDIISEIHKKVMQTKMLDEMKIFLISRMAEIEYRMAQG
SSERVNLASLVGGFNEVRSVKALK