Identifiers and Description

Gene Model Identifier

Contig2682.0.g45

Standard Name

RFC1a

Aliases

Contig2682_0_g45

Description

Replication factor RFC1 C terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009391109.997217559668329e-127BRCA1 C Terminus (BRCT) domain
SGDYOR217W2.0001503375893664e-79RFC1 SGDID:S000005743, Chr XV
from 749301-751886, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2682.0.g45(coding)
ATGATCCGCGATTTCTTTAAACAAACATCAATCAAGACCTCCGATTCAAAGGGGAAAGTA
GTCCAACCTTCTCCCGTCGCATCAAAAACACAAACAAAGAGCAAAGAACCCAACACAAGA
TTTGAGAGAAGCGAGAAACGTGAAAAATCTAAGTCTAAGCAGTCCCAGGCTACAGAAGAT
AAGAGTTCTTAATAAAATTAGAAGTCTGCTAAAAAAGAGCTCATCAAGTCAACAAATTCA
AGGAGCAAGGTTCAATCTCCCGCAAAATCTCCAATGACTCGCACTCCCATTAAAAGTTAA
CCAAAAAAAGAGTAACAAACCTACGAAGACTCATTGGAAGACGCAGAGGAGGAAGAAGTG
AAAGTTAGTACTAGATCTGCCGCCAAAAATCAAACTTTAGCTCAAAACTCAAAAGCTTAA
AAATCTCATGGAGATAAAAATACAGGTAATTCTTAGAGATCTTCCCACAAAAATGAGTCA
AACAATAGAAACGATTCTCAATCAAGAAGCAAGACCCCTATTAAGAATTAATAGCAATCA
AACATGCAAGTACCTGAGAATAAAGTAAATACTAGAAATAGTGCTAAAGCTACTCCAAAT
AAAAACTAAATTCAGTCCTAAGCAAACAATATGATTCAAAAGACCAAGCATGCTCCCCCT
TCCCCAGCTAAGAATTCCCAAAAATCTCAAAATGTTGTAAATTAGAACACTCAGCAAAAG
TCAAAGCAGCCCCAAGATACTTTCGCAGACGTGGAGATGAAAGATGAGGATGATAATTAA
GAAACTATCTCACCTTAAATTCGTTCCTCACAAAGAAATACCAGACAAAGTTAATCGAGA
GGAGCTTCTTAAAACACAAATATTCGCAGTGGTTAAAGCTAAAATGCTCAGAATGTTGCC
AATTAAAATAATCATAAATCAGATGTTGTAATGAAGTAGTAAGTTAGCGAGGATGAGGAC
GAAGATTTAGGAGCTATGATGAGAAATAGAAGAAGAGGACCTGCTGCTGTAGTTGAGGAT
GAAGATGACGATCAGGAAACTTAAATCCAAGCAAGAAACAGGCAATCGAAGAAAAGGAAC
ACAATTCTTGACGATGAAGATGAAGAGGATGTTAGAAGAACTCAGACAAATAAAAGATAA
AAAGTTACTGAAAATGAAGAGGAAGAGAAAGATGAGAAATAGCAACAGTAATCTAAATAG
AGCTAAGCTGATTTGTATTTAGAAAAGATGGCTTATTCAAAGTCATAATAGCAGCTCTCT
CAATCATCAGCTAAACAAAGTAAAAATATGCAAGCATCAGGAATGAGCCCTAGATTGGAT
AAACTTAGCATTAATGATTCTAACGCAGCTAAAAGTGGCAGCAGATAAATGCCTCAAACT
ATGAGTTAAAAGTCCAATGGCAATGCTAGAAAGTAGCAAAAACCTGCTAGTCAAGATGAA
GACATGGACTTGGATCTTGATGATTTAAGAGATGCAATTGAGGACAAGCCCTTGGAAGGT
TTAACTTTTGTGATATCAGGTGAATTCCAGATCATCTCCAGAGGGCGTTTGGAATCACTG
CTCATTGAAAAAGGAGGGAGAGTGACATCAGCTGTGTCAGGCAAGACTGATTACTTAATA
GTGGGTTATAAATTAGAGGATGGCAGAGAAGTGTCTCAGGGCAGTAAATTCGTGAAAGCA
ACTTAACTAGGAAAGACCATCCTTACTGAAAGTCAACTAGAGGAGTTTATTAAGGAGAAA
TCAGGGGATCAGAGTTTCACTATTTCCATGAGACCTGGACTTTCAATAGCTGCAAGTGCT
GATGCCAAAATGACTGATGAACAGGCGCTTAAAGCATCAGTTGAGAAGAAGAGAGAAAGT
TTGGCTCAGGATAATTAATCTATGGTTGGTAAGGAAATGTGGACTGATCTATATGCTCCT
CAATCAGTGAGAGACTTAGTTGGAAACCAAGGTGTAATTGATCAGCTATACGAATGGCTC
AAAGATTGGGATGATGTCCATGTCAGAGGAAACAAAAAGCAAGTTCATCCACGCAGAGGC
CAAAGTTGGTAAGATTTGCCAAAAGTCAATGCCACTGCAGTTCTTCTGAGTGGACCACCA
GGCATTGGAAAAACAAGCAGTGCTAGGATTGTGTGCAAACAACTTGGGTTTGAAGTGCTT
GAGACAAATGCCAGTGATACAAGAAACAAGAATTCAATTAACAACATGCTACAAGTTCTG
TCATCAAATAAATCAATAGATTACTTCAGCGTTGCAGGTATAAAGAAGCAGTAAGCCAAC
CCAGTTTCGTCAGACTCAGCTGGCTAGCAAACCAAGAAATCAGTCATTATCATGGATGAA
GTAGATGGAGTAGGTGCTGGTGACAGGGGTGGTCTGTAAGCATTAATTCAAGTGATTAAG
TTAACAAAGACTCCAATTATCTGTATATGCAACGATAGGTAAAACCGCAAGTTGCAAAGT
TTGCTAAATTACTGCTATGACTTGAAGTTCAACAGACCAAGCTAAAATGAGATAGCAAAG
AGAGTTTAGTTGATATGCCAATCAGAAGGTCTTTAAATTGACAATAATACCATTAATAAG
ATTATAGAAAGTTCAGGCTCTGACATCAGACAAATTGTTAATATTTTGCAGATGTGGAAA
AATTAGCAACTTGACACAGGTTTCTTAAAGAACATTTCTAAAGACGAAAATGTAATGATC
AATAACTTTGATGCTGCACATCGCATGCTAAATCATGGAGCTTAGAGTTTAGACATTAAA
TATCCTTAATTTAGGTAGAAAATGGACTTGTTCTTTATTGACTATGATTTGATTCCACTT
TTGATTCAAGAAAATTACTTAAACTCTATGGGAGATAGAAATAAACTTGAGGATATAGAA
CGTATGGCTTCTGCTGCTGAGTTTATTTCGCTTGGTGATAGTATCTCAAACTAAGTTCGC
AAGAATTAGGATTGGTCACTTCTACCTAATATGGGTATTTGCTCTGCTATAGCTCCATGT
TTACTCGTGAATGGTTCAACATTTTATCCTAGATTCCCTGAATGGTTGGGTAAAAATTCT
TCTCAACGCAAAGCCAAGCGTTTAATTCGTGAATTGAAGAAAGTCATGGGTCATCATGCT
CAGGCTGATAGAATGGAAATTTAGAATGAGTACACACAACTTATTCTTTCTTACTTGTAC
AAGTTCCTTAAGAAGCATGAGAAAACTGGGGATAAGGAAAATCTACACGAGTTACTAGAA
TTTATGAAAGATTTGGGACTCACTATGGAACATTTTAAGGAACATTTGATTTCTCTATGT
ATGGATAAGAAAACTTGTGAAGGATTTGATAGTCTAGCTTCCACTACTAAAGCAGCTTTT
ACAAAGATGTTTAATCAGGAAAATAAAGATAATCTAGTTGGCAAAAAAGGAAAGAAAGCT
CCAGCTGGTAAAAAAGGTGGTGCTTCACCTGCTGCCACAGCTGCCGATGACAACGGTGAG
GCTTCTGATGTAGAAGAGGAAGCAGAAGAAGAAGTTGGACAACTCATAGATGAAGATCAG
GCTCTAGAACTTAAAAAGGGCAAACAACTAGAGAAAGAAATGGAAAAGAAGAATAAAAAG
GCAAAAGTAGAGAAGTTTGAATTAGTTCAAATCAAAGGAGGAGCTCCAGCTGGTGGTAAA
GCAAAGAAGGGTGCTAAGAAAGGGGCAAAAACCACTGCAAAAGCTGCTGGCAAGAAAGGC
AAGAAGGGAGCAGCCAAAGATGATAGAAGTGAGGAAGAGTACATCAGCGATGATAGTCTC
AATGAGTTTGTTGTCGATGATGATGAAATTGAGTATGACAAAAAGGGTAAAAAGGGTGGT
GCTAAGAGTGCTGGGGCCAGAGGTAGAGGCAAAAAATGA


>Contig2682.0.g45(protein)
MIRDFFKQTSIKTSDSKGKVVQPSPVASKTQTKSKEPNTRFERSEKREKSKSKQSQATED
KSSQQNQKSAKKELIKSTNSRSKVQSPAKSPMTRTPIKSQPKKEQQTYEDSLEDAEEEEV
KVSTRSAAKNQTLAQNSKAQKSHGDKNTGNSQRSSHKNESNNRNDSQSRSKTPIKNQQQS
NMQVPENKVNTRNSAKATPNKNQIQSQANNMIQKTKHAPPSPAKNSQKSQNVVNQNTQQK
SKQPQDTFADVEMKDEDDNQETISPQIRSSQRNTRQSQSRGASQNTNIRSGQSQNAQNVA
NQNNHKSDVVMKQQVSEDEDEDLGAMMRNRRRGPAAVVEDEDDDQETQIQARNRQSKKRN
TILDDEDEEDVRRTQTNKRQKVTENEEEEKDEKQQQQSKQSQADLYLEKMAYSKSQQQLS
QSSAKQSKNMQASGMSPRLDKLSINDSNAAKSGSRQMPQTMSQKSNGNARKQQKPASQDE
DMDLDLDDLRDAIEDKPLEGLTFVISGEFQIISRGRLESLLIEKGGRVTSAVSGKTDYLI
VGYKLEDGREVSQGSKFVKATQLGKTILTESQLEEFIKEKSGDQSFTISMRPGLSIAASA
DAKMTDEQALKASVEKKRESLAQDNQSMVGKEMWTDLYAPQSVRDLVGNQGVIDQLYEWL
KDWDDVHVRGNKKQVHPRRGQSWQDLPKVNATAVLLSGPPGIGKTSSARIVCKQLGFEVL
ETNASDTRNKNSINNMLQVLSSNKSIDYFSVAGIKKQQANPVSSDSAGQQTKKSVIIMDE
VDGVGAGDRGGLQALIQVIKLTKTPIICICNDRQNRKLQSLLNYCYDLKFNRPSQNEIAK
RVQLICQSEGLQIDNNTINKIIESSGSDIRQIVNILQMWKNQQLDTGFLKNISKDENVMI
NNFDAAHRMLNHGAQSLDIKYPQFRQKMDLFFIDYDLIPLLIQENYLNSMGDRNKLEDIE
RMASAAEFISLGDSISNQVRKNQDWSLLPNMGICSAIAPCLLVNGSTFYPRFPEWLGKNS
SQRKAKRLIRELKKVMGHHAQADRMEIQNEYTQLILSYLYKFLKKHEKTGDKENLHELLE
FMKDLGLTMEHFKEHLISLCMDKKTCEGFDSLASTTKAAFTKMFNQENKDNLVGKKGKKA
PAGKKGGASPAATAADDNGEASDVEEEAEEEVGQLIDEDQALELKKGKQLEKEMEKKNKK
AKVEKFELVQIKGGAPAGGKAKKGAKKGAKTTAKAAGKKGKKGAAKDDRSEEEYISDDSL
NEFVVDDDEIEYDKKGKKGGAKSAGARGRGKK