Identifiers and Description

Gene Model Identifier

Contig10831.0.g33

Standard Name

RFA1

Aliases

Contig10831_0_g33

Description

Replication factor-A protein 1, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam04057 ) Replication factor-A protein 1, N-terminal domain
  • ( pfam01597 ) Glycine cleavage H-protein

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10831.0.g33(coding)
ATGCACTTGAATGTCTTGGAATCAGATCATAATGAGAAGGAATGCCTGGATTTGATGGGG
AAATTGAAGACTTTCCTGGTTTTGGAGGAAGCCAAGCAAGTTGACTGTCTGAATCCTGAG
GAAGAAGACATGATGGCGATCAGCAGTAAACCATCAGAAAAGTTCAAGGCTAGAATCAAT
GATAAAATCAGCTAATATCAAGCACTTGACAACAAAGAGAACCAGGAAATACTTAACAAT
AATAGAAAGGAAGACACTTGGATTGCGTAACTATCGAAATACTCCGATTAAGAGATTGAT
GAGGAAGAATAACACATTATGATGAAAGAAACTGAGAAGTAAAACCAATGGTATTCAAAA
CTCATTAGATGA


>Contig10831.0.g33(protein)
MHLNVLESDHNEKECLDLMGKLKTFLVLEEAKQVDCLNPEEEDMMAISSKPSEKFKARIN
DKISQYQALDNKENQEILNNNRKEDTWIAQLSKYSDQEIDEEEQHIMMKETEKQNQWYSK
LIR