Identifiers and Description

Gene Model Identifier

Contig15099.0.g103

Standard Name

REXO2b

Aliases

Contig15099_0_g103

Description

Exonuclease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001126105.999333866290414e-37exonuclease family protein
SGDYLR059C1.9994498063102785e-22REX2 SGDID:S000004049, Chr XII
from 260547-259738, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15099.0.g103(coding)
ATGGATGCGTGGTGTACTAAGTAACATAATGAAAGTGGATTAGTGCAGAAAGTCAGAGAT
TCTCAAATCACTCTCGCTTAGGCAGAAGATTTGATAATAGAGTTCTTGCAAAATACATGC
CAATTGAAATCTTTTACATGCCCCTTAGCTGGCAACTCAGTTGGTGAAGATAAGAAATTC
TTGCAAAAAGATATGCCTAAACTCTACAATTTCTTGCACTACCGCATTATTGATGTGTCA
ACTATTAAGGAATTGTGCAAGAGATGGATTGGTGATCCTACCGCACAAAATGCTGCTGGT
GATCACTGGAAAATAAATGAGAAAATTCAACCAGCATTCGTGAAATAATGCACCCACAGA
GCTCTAGATGACATCAGAGAGAGTATAGCTGAGCTAAAACACTACAAAACTCATATTTTT
GATAAAGTCATTAATATACACACTCAAAGCCAGTGA


>Contig15099.0.g103(protein)
MDAWCTKQHNESGLVQKVRDSQITLAQAEDLIIEFLQNTCQLKSFTCPLAGNSVGEDKKF
LQKDMPKLYNFLHYRIIDVSTIKELCKRWIGDPTAQNAAGDHWKINEKIQPAFVKQCTHR
ALDDIRESIAELKHYKTHIFDKVINIHTQSQ