Identifiers and Description

Gene Model Identifier

Contig10568.0.g83

Standard Name

REXO2a

Aliases

Contig10568_0_g83

Description

Exonuclease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001126109.003334616687074e-54exonuclease family protein
SGDYLR059C1.9991517704232713e-32REX2 SGDID:S000004049, Chr XII
from 260547-259738, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10568.0.g83(coding)
ATGGACCATAATTAAGCTTTCAACGCCTACCCCAACTAAATATAGCTCAATCCGAATGCC
TTTTCAATTACAGACCAGCCTATAGTTTGGATTGACTTAGAAATGACAGGTTTAAACGTT
TAATTTGAGAAAATATTGGAAATTGGCATCGTTATAACAGACTCTAAATTGACTAAGAAG
GTGCTAGGACCTAATATTATAGTGTAGTGCGATGAATATACTTTACAACATATGGATGAC
TGGAATCAAACCCATCATAAAGAAAGTGGGCTACTCGCTTAAGTAAGGCAATCTAATGTA
TCTTTGGAGTAAGCAGAGCAGATAATACTAGCATTTTTGCAAGAAATGCAGGTTACTTAC
TAAAGTGCGCCTCTTGCAGGGAATTGCATTCACACAGATCGCAAATTCATGAGAAAATAT
ATGCCAAATTTGGTAGATTATCTAAATTACAAAATCATAGACGTGACCACTTTCAAATAA
TTATGTTGGCGATGGAATTAATAAGTTTCAAAAGGTAGACCCAGAAAAGCTCAAGGTCAT
AGAGCACTAGATGATATACTAGAAAGTATAGAGGAAATGAAATACTATCAGGATAAATTT
ATTAAACTTGGAAATAAATGA


>Contig10568.0.g83(protein)
MDHNQAFNAYPNQIQLNPNAFSITDQPIVWIDLEMTGLNVQFEKILEIGIVITDSKLTKK
VLGPNIIVQCDEYTLQHMDDWNQTHHKESGLLAQVRQSNVSLEQAEQIILAFLQEMQVTY
QSAPLAGNCIHTDRKFMRKYMPNLVDYLNYKIIDVTTFKQLCWRWNQQVSKGRPRKAQGH
RALDDILESIEEMKYYQDKFIKLGNK