Identifiers and Description

Gene Model Identifier

Contig22416.0.g98

Standard Name

REX4b

Aliases

Contig22416_0_g98

Description

Exonuclease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOL080C9.997975313387782e-28REX4 SGDID:S000005440, Chr XV
from 181427-180558, Genom...
T. thermophilaTTHERM_000088002.0009605191578312e-25exonuclease family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22416.0.g98(coding)
ATGGAAGAGTCTGTGTTTGAACCTACAGCTTTTACTGAGAAGCACATCATTGAAGATTTG
ACTATTCACCCCTACAACCCTAAGAAACCTATGATCTACTATCAGATGCTCAATTAAGCA
AACAAGCGTGGAAAGGAGACTGAGATTTTGGCACTTGACTGTGAAAGGATTCTGACAAAG
AAGGGAGAGAGACTTGCAAGGGTATCTATTGTGAACTACTATGGCAACATAGTATTTGAT
TCTTTGGTTAAGCCCTGGGCTAAAGTTTATGACTACAGAGAATGGATCACTGGAATCAAA
GCTCTTGACTTAAAACATGCACCTTCTTACCCTAAGATGGCGCCCTTGCTGAAGAAGATA
CTTGACAAGAAAATTGTGATCGGTCACTCTCTTGATGATGACTTTAAATCTTTGAAGTTG
AACAACGAGGAGTACGAGTGCGAAATCAGAGAGATTTCTGAGTTTACTCTTTTTCAGAGA
CCTGTTTTGAATGGAGGGTATGAAAGACGTAAACTCAAGGACCTGGCCAAAGAGTTTTTG
AATGCTTCAATTCAAGAAAGTCATCACTCTTCTGTGATCGATGCAAGGATAGCACTTGCC
CTCTACAGGAAATATGAGCAAGAGATTGAGAGGTAACTCTAAGTTCTGAAAAATAGCAGC
TATATCAGTAATAATTTGTCCCCAACTATCAACCTCAACAGCAACTAGATTTCAAGCTTT
GTTGATGTGACTGAACTTCCTATGATAGCTGATTTGCTGAAATAAATCTAGCTTTTGTCA
CCTGTGATGAACGCAGCTTACAACTCATCACCTTCCCCTTCGCCAAATACTTAGATCTAT
GAGATTTCAGAGGAGCAGAATGAAGAAGATTCCATACTAGAAATTCCTCAGAAAAAGACC
AAAGAGATGTATCTTGAAACCACATTTTAAGATGTGTCTGAGTTCAACATTTTGGAATCG
TCTAAGCAACCAAAACAAGACTAGCCAAATTCATTCAGTCTTTTGAGACCCTTCATGAGT
CGCATTGATGAGTTTTAGGAGTTCAAGTAGAAAGAATTTCATGACAGCTCCCAATCACTC
TTCTCAACTTCTTTCATTTTCAATTCAGTGTCTGCACAACTCAACAACCCTGAAGAAGAA
AATCTCCTTCCCAAGTCTTTGTTTGAAGAGGTTGGCCCTTCATCTCCCTGGAAGCCACCC
AAGCCCAAGCAAGATCAAGAGCCAAAAGTCAATCCATCAGGCATAGATACCTTCTACAGG
AACCACTACTCAAGAGACTATGTTACAGGGTAACTTCAACAGGAGAGTTTGTAGGCAAGC
AAGTCGCTTTCAGACCAAGAGCAATTTCAACCATCTCAAGTACCTAGAGAATGA


>Contig22416.0.g98(protein)
MEESVFEPTAFTEKHIIEDLTIHPYNPKKPMIYYQMLNQANKRGKETEILALDCERILTK
KGERLARVSIVNYYGNIVFDSLVKPWAKVYDYREWITGIKALDLKHAPSYPKMAPLLKKI
LDKKIVIGHSLDDDFKSLKLNNEEYECEIREISEFTLFQRPVLNGGYERRKLKDLAKEFL
NASIQESHHSSVIDARIALALYRKYEQEIERQLQVLKNSSYISNNLSPTINLNSNQISSF
VDVTELPMIADLLKQIQLLSPVMNAAYNSSPSPSPNTQIYEISEEQNEEDSILEIPQKKT
KEMYLETTFQDVSEFNILESSKQPKQDQPNSFSLLRPFMSRIDEFQEFKQKEFHDSSQSL
FSTSFIFNSVSAQLNNPEEENLLPKSLFEEVGPSSPWKPPKPKQDQEPKVNPSGIDTFYR
NHYSRDYVTGQLQQESLQASKSLSDQEQFQPSQVPRE