Identifiers and Description

Gene Model Identifier

Contig15018.0.g60

Standard Name

REX4a

Aliases

Contig15018_0_g60

Description

Exonuclease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000088002.9995979253168707e-35exonuclease family protein
SGDYOL080C4.001714826231863e-32REX4 SGDID:S000005440, Chr XV
from 181427-180558, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15018.0.g60(coding)
ATGGTAGAGAAAATAAATGCTAAATAGGAAGCATCTCAGATGTTAAGTCTTATGAATATA
GTCATTGGAGAACAGTAAAAGAAATCAGAAAATAATAAGAAGCGTCTTATCAAATACGAT
AATAAATAGAATCACAGAGAAGTGAAAAATGTGTCCTAGAACTAACAAAATGGGAATCAT
AGAACAGTTTAAACTAGTAATCGCGATGAAAATGTTTCATTGGTTGATCAGATCTTCAAA
CCTCAGCACACAACTTTCAAAGGGGATACACCTTTGGTTTCAATTGATTGCGAAATGGTA
GAAGTTGATAAGTTTTCAGAAGGCTTAGCTAGAGTGTCGATAGTAAACTATAATGGGCAT
GTACTATACGATTAATATGTGCGACCAGAAGGCAAGATTACTAACTTCCGTACTTGGGTG
TCAGGCATAACTCCAGCCAATATGCTAAAATCGAAACCATTTAAAGAGGCGTTAGCTGAT
GTCCATAGAATGTTAAAAGGAAAGACCATCGTTGGGCATTCATTAAAGCATGATTTTGGA
GTTCTTGCTATCAGAGAGGAAAATGCTGCTCAAGGCTTTATCGAGAGAGTAAACGAAGAA
GATTAATAAATAGATGAAAAAGCGAAGTTGCTATAGGAAGCTCTAAATTCAGGTCATTAA
ACAAACTCAGGCTGTAAAATAATGATTATAGGAAAAGACAAAATTAGGGATATCTCAAAA
TTTAAGAAGTATCAAAATTAGAGTGGACAAGCTATCTCCCTGAAAAAGTTAACTGAATAA
TTCTTGGAAAGAAAGATTTAAGAAGGATCTCATTGCTCAGTAGTAGATGCAAGAGCAGCA
ATGGCACTTTATAGAATAAACGAAAAAGAATGGGAGAACAGCGTTAAACAAAAATCCTAC
TCTAATGTAAAGAAAAGAGTGGCTTAAGATGTAGGGAACTTAGCTAAATTCTTCGGCAAC
TCATAATTGACAAATAATACTACAACTGCTTCAAATAATAACTCAAGTGCAAATGCTTAA
AATAGTAGTAGCACCCAAAATACAAGCATCAATAGTGCTATAAATAATTAATAAAAAGGG
TAGATAATGAGCAATAGTATGAACAAATTCTTTGGTGGGCAACCTAATAACTAGAAAAAG
AAGCTCAAAATATGA


>Contig15018.0.g60(protein)
MVEKINAKQEASQMLSLMNIVIGEQQKKSENNKKRLIKYDNKQNHREVKNVSQNQQNGNH
RTVQTSNRDENVSLVDQIFKPQHTTFKGDTPLVSIDCEMVEVDKFSEGLARVSIVNYNGH
VLYDQYVRPEGKITNFRTWVSGITPANMLKSKPFKEALADVHRMLKGKTIVGHSLKHDFG
VLAIREENAAQGFIERVNEEDQQIDEKAKLLQEALNSGHQTNSGCKIMIIGKDKIRDISK
FKKYQNQSGQAISLKKLTEQFLERKIQEGSHCSVVDARAAMALYRINEKEWENSVKQKSY
SNVKKRVAQDVGNLAKFFGNSQLTNNTTTASNNNSSANAQNSSSTQNTSINSAINNQQKG
QIMSNSMNKFFGGQPNNQKKKLKI