Identifiers and Description

Gene Model Identifier

Contig18916.0.g48

Standard Name

REV3

Aliases

Contig18916_0_g48

Description

DNA polymerase family B

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00136 ) DNA polymerase family B
  • ( pfam03104 ) DNA polymerase family B, exonuclease domain
  • ( pfam14260 ) C4-type zinc-finger of DNA polymerase delta

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPL167C3.001476460448119e-154REV3 SGDID:S000006088, Chr XVI
from 237107-232593, Geno...
T. thermophilaTTHERM_004376503.0009656946748407e-152DNA polymerase family B contai
ning protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18916.0.g48(coding)
ATGAACTCATACTTTTCTATGCGAGTTTTCTACAACGATCAGCTCTAAGGTAAATTCAAT
ATCGAATAGTAAGAAAAACTTCATTAAATTAAATCTCCAGTGTTTCCAGATAGAAAAATT
AAAAAAGTTCCTGTGTTAAGATTGTTTGGTATTACTAAGAGAGGTTAAAAAGCATGTCTA
AACATATTTGATTACTATCCATTTCTTTACTGTGAATTTCCAGTGCAAATATTCAACATT
GAGAGATCTACGAGTGAAGAGCTTTAAGTATTTTTGTCAGATTTTGCTTTCAACTTAGAA
TTTGCTCTGTATTTGAGCATTTATCAGAAATCAGGATTAAAATCTCCAAGAATTTTACTA
AGGGAGTTTGAAGATAAAAATGAATAACTAGTTCATAATTGTGAATTAGCTTACAAGTAT
CCAATCTATGGCTACTACACAGAGAAAAAACCATTCATAAAAATTGAGTTGTACCATTCT
ATTCATGTTAAAAAATGTGCAAACATGCTTTACTCTGGAATTTTATATGGAATAGCGATG
CAGCCATACGAAGCTCATTTGTCCTATCATATGCATTTCTATGGAGATTATGGAATCAGT
GGTCTAGATTTCATTAAAGTTATGGATGTGATGATTAGAAATTTGGAGAGCTTTGATGAA
GAAAAGAGAGAGTTAATACTCAAAAGAAAGTCATTCTATTCCTTAATATTTTCAGAGATT
TCAGGTGAAGGAAAAGTAATATGGGATGAAGAATTTAAGCAAAATTCAAGGAGGCAATCT
GCCATGAGTATTAGAAAAAGTTAATAGTCATTAAAGAACTAGCTCTAAAATATCGTAAAT
CAATAAAATTGCAAAGACTACACGTTTCTACATGATGATATCAATCTTAAATTGTGGCAT
TCAGAAATGACTGAGCTAAGTGAACAAGGCAAAAATATTGACAGTTTACTCAGTCCTTAT
CAAAGAATGAGTTCTTGTGAAATTGAACTAGATTGCAATTGCAGAGATATCTTGAATATC
TGGGAGAATGACCAAAATTTGTTGGGATCTATGATTGGAAGGAGCAATAACAATGACGAA
GCTTTAAAGTTAAGAAGCTAAGATGTAGAAGAAAATAAGAAGTAGAATCATAGAGCAAGT
GGGCAGTCTAATGTTAGCATAAGTAGTTCATTCATAGATAATGCTATGGATAAATTACTT
GGAGAAGTTTAAGAGCCAACATATTAGAGGCATAGTTATTCATAAGAATCTATGAAATTT
CAAGATGAAGACTTGTTGATGAAAATTTACATTGATTAACAAAAAAAGTAGCAAACTTAA
CAATAAATTTCTGATTATTCAGAATCAAGATTGTTGTCAGATTTCAGCAATACTTCTTTT
TAGCTCAATTAAATAAATCTTACTCCATTAGAATTGTCACCAAACAGCAAAAGTGTTGAT
TAACAATAGGTTCAATAATAAACGCCTGATTTCAAATTAAACTAAATTCATCAAATAAAA
GAGGTTTTATAGACTCCATTATAGTCTGAGAATCTCGATTAATAGTTTACCAAATATTCT
CAAGATATAAAATACGTGAGATCCCTTGTAAATCTGTGGAAAGAAGAATTTATAAGACGT
AAGCATTAAGGTCTTCCCGACATGGAGAGAGCCTAAATGTCTGATGACACAAGAACAGGA
GGTTATTCTCAGAGTTTAAATGACTAAGAAAGAGTGCAAAACTTTCTCTTAAAACATTTA
AGAACAAAAGCCTAAAATGTACAGTCCTTTAATTCAGTCGACTGTGAGTTATATAAGCAA
CTGGAAAAGATCGACTTCGAAGCACTTTCGATATTTATACAGCAAAAAGAAGAACTTAAT
GACGAGACTGACATGCAAGAGAGATTTTAGATGCTAGGATTTTTCAACATGAGATAAATG
TAGGATGACAGGCATACAAGAGCTTTATAAAAGAACTTGTAACATACTTTAAACTCAGGA
ATTGATGACCCTACTCAAGCAGCAGCAGCTGATTAGGAGGACGAACTTGAAGTTTTAGAC
ATAATGGAATCTTTAAAAGATTAGTATGAGAATATTAAGCAAAGGCGAGAGGACCATAAG
ACTACTAAAGCAAAATATAAAACTGGAAAAATCGGAAATGATTTGCAGAACAACAAATCT
ATTTTTGATTATATGTCTCCAACAAGAAACACTAAAAAAATGGGAGACACTGAAATGGAA
GACGAATGTGAAATAAATGAAGAACCAAGTTCATTCAATTTAAATGGAGCAGACTTAGAC
AATATATTAAATGGACTGAGTGATAATGAATCTAACTACGAATAAATTAATGTGAATGAT
CAAGAGGATGAAATTGATAGTATTGAACAAAGCTTATTGGGAATCTAAACAAGTGACTTA
AAGCAGAAACTACTAAAGTAAAGCAATTTTCAACTTGAAGAGGTAAAAGAAGAAGATGAA
AATAGTCAGGATGAAAGCATAAATTGGGCTTAAATGGAGTCGCTTATTAATAGTGAACTT
AATCAAGTCATTAGTAATTAAGGGGAGGAGTCGTAAGGGATGAATGCTATTTCCAATAGA
AATATGGATGTGGAGATGATCAATGAAGAATAAAAAGAATAAATAGTGGAATATTAACCA
AGACACATTCTCAAGGGTGATAAAATAGTGAGAGTGAGGTCGCCAAAGAGAAAATAACCA
AATGATATCAATCATTAACTAGCTTATTTTAGCAAGAAAGGAGACTTAATTGAGCATTTA
TAACATGCCAAATAGATAAGATTTATGACTTTGTGCATATTATTTCTGATGAACAAATAA
CTTTCACTAAAAGAGGGCCATTAGCTTCTAAATTAAAAAAGAAATATGCTTAAAAACAAG
TAAAAAATGAAAGTTGATATTGATTAAGACTTGAAACTATAAGCAAAAAGAGAAATGATT
GGAAATATCTCCTCTAGTAGTGGTCCAAATAGATTTATAACACCTGCTACTTAATATGCA
TTAAAAAATTTAGATTCGCAACAAAATGTAGGAGGATTTGAAAGAATGAGGGATTAGGGA
TTATAAGATAATCCTAATGAGACTTTGTTTGATATACATCAAGAATTCTAACTTATTAAT
GGTATAACAGTTCTTTATCTGGAAGTTATGGTCTGCAATAGAATGGGATGTGCAGTATTT
TTTGTGCTTCATAATGAGTGTGCATAATTAGACTTAGGTGCAAATTATAGAAAAGTTCAT
GGTGTGATAATTAATAAACAATAATCGAAGCAAATAAAAGCCCCTGAAAATTCAGGCACT
TATTAACCAATAAACTATCATTTGATAGCTAAAAATGAAGTCAACTTGCTTTAAAAGGTG
ATTGAATTGTTTCGAGAATTCGATCCAGACATTATTGTGGGACATGAAACTGAGGCTATG
AGCATCGGCTATATCTGCAAAAGAGCTGAATAAATTGGTATCTAAATGTCCAATTTACTC
TCTAGAACTCCAATGACATTAAAGCCATTAAACGAGAGTTTCTACAATTAAAAATTGTTA
AAAGAGTCCAAGTTACATCACCAAAGCGTTGATGATTAAATGGATTAGGATGAAGCATTA
CGGTAATAAAATTAAGGTTCAGTGAATGAAAAGAAGAAGAAAATGGGTGTTTTCTATTAG
AAGTTTGGTCAATAAGTAAAACTTAATGGAAGAATAATAATCAATCTTTGGAGTGTTTTG
AGAAATGAGATAAATCTAACAAACTATGATTTGGAAAATTCATGCTTTCACATTCTTAAA
AAGAGAGAACCTAGATTTGATTATGATATGCTGACTATGTGGTGGTAAAGAGGCTAATTT
AGTCATGTTGCAAATTATTTGATCAAAAGGCTATTGAACATTGAGGCTATTCTTGATACA
TTGGATCTAATCAATAGAGATATTAACATGGCAAAAGTATATGGAATAGATTATGAAAGT
ATTATGACTCGTGGTTCTCAATTTAGAGTGGAATCTTTACTCTCTAAAATCACAAAATCT
TAAGATTTCTTGCTTTTGTCTGCATCTGTTTAACAAGTAAGGTAGCAAAATGAGTTAGAA
GTTATTCCTCTGGTTATAGAACCAGATAAACAATTTTACACAAGTCCTGTTGACATAGTA
GATTTTTAAAGTCTGTATCCCTCAGTTATTATTGCCTATAATTTATGCTACTCTACTTGT
CTTGGTAAAATTATACAAATAAATCCAGAAAGTACCTCTAATAAAAGAAAGCTAGGTGTC
TATAATATTCCTGCAAACATCAAATCCTTTTTTGGCATTGAAAATGATTAAGATTTGACA
GAAGAGTAGGAATAGTATATCTTAGACAGCATTATAATAGCACCAAACTTAAATTGTTTT
GTCAAGCCACATTTAAGATTAGGTTTACTTCCCAGAATGTTGAGGGAAATCTTATACACT
CGTATTATGGTTAAGAAATCAATGAAATTATACAAACCAGGATCCACAATATACAGAATG
CTTGATTCAAGATAGCTTGCTTTAAAACTTATTGCAAATGTAACTTATGGATATACTGCT
GCAGGATTTTCAGGTAGAATGCCTTGTTCTGAATTCGCTGATAGTGTAGTCTCTATAAGT
AGATAGACCCTAGAAAAGTGTATGAAAATTGTCAACTAAAACGAGGATAATTGGGGTACG
AAAGTTATATATGGAGACACTGATTCAACTTTTATCCTTTGTGAAGGAAAAACTTTGGAA
AAAGCCTTCGAAATTGGAGAATTAATTGCTAAAACTGTCACTTCTATAAATCCTTTCCCT
ATGGAATTAAAATTTGAGAAAGTCTATTATCCATGTGTAACTCTTGCTAAAAAGAGATAT
TGTGGCTATAAAATGGAGAAAATTACTGATAAACCATCTCTGGACGCTAAAGGTATAGAA
ACTATCAGAAGAGATACTGTAGATGCTGTCTAAAAAATAATGGATAAATGCCTGAGGTTA
CTCTTTGAAACTAAAGATTTATCTTAAGTGAAAGATTATCTTATCAGATAATGGACTAAA
ATACAGAATGGAGATGTTGAATTTAAAGATTTTATATTTGCTAAGGAAGTAAGATTCGGA
TCATATCGAACTTTACCACCGAGTGCTATAATTTGTGAAAGACGCCTTGAAAGAGATCCC
GGGGCTATGCCTAGATACAAAGAACGTATACCATATGTGATAGCTATGGGTTAAGGCGGA
GCTATTGATCAATCTAAAATAAAAGATTTAGTATTATCTCCAGAAGAATTTTTATCATCT
GATGGTTTGATGCTCAATGCACCTTACTATATAAAACGATAGATAAATGCAGCAATAAAT
AGAATCTTTCTTGAGATATTTGACATAGATGTGAATTAATGGTATATAAAGATGCCTAAA
AAGACTAAGGAACATGGAGTATTTTCAAAGCGTATTGACTATTTCAATAGACAAATTAGC
AGTGCAAAGTCTACTATTTCTAAATCAATATTTTCTGGATCAGCTCTAGGTTCTAAGACC
TCAGTACGTAGTGGTGCATCCTCCTCTTCAAGCATTGCAGGCTAAAATTCAATGATGATA
GACCAATTTTATAATAGAAAATCCTGCATTGTTTGCTCAGAAAGTTCTCTTGTTAAGCTC
TGCAAATAATGCTCAAAGAACATTAGAGAGACAGTTTATATCTTGAATCAGAGACTTTAA
AATCTTTAGAACAAGATTGATAAAATAAATTTAGTATGTTTAGCTTGCTCCAACATGCTT
TTGAGAGGGAGAGTAGCTGCATTAGTTGACCATTCAATGAATGATGATGGCATTAGTAAT
GAGATAGTGCCATGCATCAATTATCAATGTAAAATATTTTATGATAAAATTGCACTAAGC
AAAGAATACTGGTATCTTAAGGATGTTATTAAAACTCTTAATTTAAGTTATTATTGA


>Contig18916.0.g48(protein)
MNSYFSMRVFYNDQLQGKFNIEQQEKLHQIKSPVFPDRKIKKVPVLRLFGITKRGQKACL
NIFDYYPFLYCEFPVQIFNIERSTSEELQVFLSDFAFNLEFALYLSIYQKSGLKSPRILL
REFEDKNEQLVHNCELAYKYPIYGYYTEKKPFIKIELYHSIHVKKCANMLYSGILYGIAM
QPYEAHLSYHMHFYGDYGISGLDFIKVMDVMIRNLESFDEEKRELILKRKSFYSLIFSEI
SGEGKVIWDEEFKQNSRRQSAMSIRKSQQSLKNQLQNIVNQQNCKDYTFLHDDINLKLWH
SEMTELSEQGKNIDSLLSPYQRMSSCEIELDCNCRDILNIWENDQNLLGSMIGRSNNNDE
ALKLRSQDVEENKKQNHRASGQSNVSISSSFIDNAMDKLLGEVQEPTYQRHSYSQESMKF
QDEDLLMKIYIDQQKKQQTQQQISDYSESRLLSDFSNTSFQLNQINLTPLELSPNSKSVD
QQQVQQQTPDFKLNQIHQIKEVLQTPLQSENLDQQFTKYSQDIKYVRSLVNLWKEEFIRR
KHQGLPDMERAQMSDDTRTGGYSQSLNDQERVQNFLLKHLRTKAQNVQSFNSVDCELYKQ
LEKIDFEALSIFIQQKEELNDETDMQERFQMLGFFNMRQMQDDRHTRALQKNLQHTLNSG
IDDPTQAAAADQEDELEVLDIMESLKDQYENIKQRREDHKTTKAKYKTGKIGNDLQNNKS
IFDYMSPTRNTKKMGDTEMEDECEINEEPSSFNLNGADLDNILNGLSDNESNYEQINVND
QEDEIDSIEQSLLGIQTSDLKQKLLKQSNFQLEEVKEEDENSQDESINWAQMESLINSEL
NQVISNQGEESQGMNAISNRNMDVEMINEEQKEQIVEYQPRHILKGDKIVRVRSPKRKQP
NDINHQLAYFSKKGDLIEHLQHAKQIRFMTLCILFLMNKQLSLKEGHQLLNQKRNMLKNK
QKMKVDIDQDLKLQAKREMIGNISSSSGPNRFITPATQYALKNLDSQQNVGGFERMRDQG
LQDNPNETLFDIHQEFQLINGITVLYLEVMVCNRMGCAVFFVLHNECAQLDLGANYRKVH
GVIINKQQSKQIKAPENSGTYQPINYHLIAKNEVNLLQKVIELFREFDPDIIVGHETEAM
SIGYICKRAEQIGIQMSNLLSRTPMTLKPLNESFYNQKLLKESKLHHQSVDDQMDQDEAL
RQQNQGSVNEKKKKMGVFYQKFGQQVKLNGRIIINLWSVLRNEINLTNYDLENSCFHILK
KREPRFDYDMLTMWWQRGQFSHVANYLIKRLLNIEAILDTLDLINRDINMAKVYGIDYES
IMTRGSQFRVESLLSKITKSQDFLLLSASVQQVRQQNELEVIPLVIEPDKQFYTSPVDIV
DFQSLYPSVIIAYNLCYSTCLGKIIQINPESTSNKRKLGVYNIPANIKSFFGIENDQDLT
EEQEQYILDSIIIAPNLNCFVKPHLRLGLLPRMLREILYTRIMVKKSMKLYKPGSTIYRM
LDSRQLALKLIANVTYGYTAAGFSGRMPCSEFADSVVSISRQTLEKCMKIVNQNEDNWGT
KVIYGDTDSTFILCEGKTLEKAFEIGELIAKTVTSINPFPMELKFEKVYYPCVTLAKKRY
CGYKMEKITDKPSLDAKGIETIRRDTVDAVQKIMDKCLRLLFETKDLSQVKDYLIRQWTK
IQNGDVEFKDFIFAKEVRFGSYRTLPPSAIICERRLERDPGAMPRYKERIPYVIAMGQGG
AIDQSKIKDLVLSPEEFLSSDGLMLNAPYYIKRQINAAINRIFLEIFDIDVNQWYIKMPK
KTKEHGVFSKRIDYFNRQISSAKSTISKSIFSGSALGSKTSVRSGASSSSSIAGQNSMMI
DQFYNRKSCIVCSESSLVKLCKQCSKNIRETVYILNQRLQNLQNKIDKINLVCLACSNML
LRGRVAALVDHSMNDDGISNEIVPCINYQCKIFYDKIALSKEYWYLKDVIKTLNLSYY