Identifiers and Description

Gene Model Identifier

Contig20812.0.0.g27

Standard Name

REV1d

Aliases

Contig20812_0_0_g27

Description

impB/mucB/samB family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004553091.9998099689916736e-77DNA polymerase IV / kappa

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20812.0.0.g27(coding)
ATGCTAAGCTAAGACAGACACATTTTGGATTACTTACTCTAAGATTTTGACCATAATGAA
GCTCCTTAAAATTAAGATAAACTTTAGGCCATAAAGAAACCAAGGAAAGGACCTCTTGTA
AAGAAAATCAAGAAACCATCAATTCCAGATCCTTATTAGACAATGAAACAACTTGATAAA
ATGCATATTAATATGCCTACTTATGACGAAGATCCTATTGAGGATTTCAATGAAAATGGT
AGTATGCAGGAGAATCATAAGAGCAATGGCTCTTTAAAAAGAGAAGATTTATCAAGAGAT
TTGGAATAAGATCACTTAGATGAGTTGGAAGATGAGAAAAGTGGCAGCTACAATTATCAG
TCAAACTTCCAAGAGGATGAATATATGATTGAAAATCTCAGTCAACAAATACAACAACTT
CTTAACGAAGAAGATGATGATGCTAATAGATAGAACTTATTTGAAACGCATTCTTAAGAA
ATCAGGGAGATAGCTGAAAAAGAGAGATTAAAAATGCTTGAAGAATAGAAAGTGAACTCA
AGTGAAAATTAGGTATAACCAAATTAAAACGACGCTACATCAATAATTTAATAGTCACTG
CGCAAGAAAGGGAAATGTCCCGAAGATATTCAACAAAGAATATTTTAGATTAGTAAAGGG
TCTGAATACCAAAAATAAGAAGAAAAACGAAACATATAGGTTAAGGAGAAGCTGGAGAAA
TATTTAGCAAAGATTAATAGAATGTCCAATAATGCAGATTCTTGGAACTAATTAGAGGTA
GGTATAAAATACTCAAAATTCCCATTAAAGCTATAAAGTTCAAATAAAAGGACTACTTTT
TATTGGGAGCAACAGCTCGAGGTGAAACGCAGGATTTAAAAGCATCGAACTGAATTGGTA
ACTGAACGTACATGGATCCACATCGATATGGACATGTTTTATGCAGCTATCGAGATCCGA
GATAATCTAACATTAGCAGACAAGCCAGTTGCAGTCGGAGAAATGAACATGATTCAAACT
GCAAGTTATGTAGCCAGAGAATACGGAGTGACTAGTGGCCTTCCAGGTTTTATTGGGAAA
AGGTTATGCAAGGATTTGATCTTTGTTAAGCCAGACAAAGAAAAATATCAGAAAGAATAT
GCAGAGATCAAGAAGTTACTATAGGATTTCGATCCTTTGCTAGAATGCCCATCACCAGAT
GAATTCTTGCTTGATGTTACGTAGTACATTAAAACTTATAACCTCGATGATGACTTGGGA
AGAATATTCCTTGGCGATAAAATAAGGAAACTTATTCTTTAGAAAACTCAACTCACAGCA
TCATGTGGAGTAGCATGTAATAAACTTCTTGCAAAAATATGCTCAGACTTCAATAAACCA
GATGGACTTACATTTCTACAATTAAATGCAGTTGAAATCTCAAAGTTCATGGACAATTTA
CCAATTAAGAAGCTGTAAGGTATTGGAAAAGTCACTGAAATGATCATGAATGGTCTTGGA
ATCTTCAATTGCAAGGATATAGTTGTAAAAGCGCGAGAGATCTACATAAATTTCACTGAA
AATGTGTTTGACTTCTTAGTAAAGTCTGCTCTTGGAATAGGTAAGAACTTGCATGATGAG
CAAACTCAAATAAAGAAAAGTTTGAGTGTGGCAGAATCTTTCAAAAACATCAACGATTAT
GAGTTGTTAAAAAATAAAGTGATCGAACTTGCCAAAGAATTAGCATAGAAATGTGTTGCT
GAATAGTTGCTTGGAAGGACGCTTACTATGGAATATAAGACTAAAAATTTGTTAACTAAA
TAGAAGTACACTTCAAATATACAGCCATACAGACAATATTCCTCAAGCATTTATACCGAC
AATGAAGAAGAGCTAGTTAACGTCTCATTGAAGCTCTTTCATTAAATTTGGCCAATCGAT
GGAGGGATGAGAATGATAGGATTGAAGTTAATTAACTTGATGCACAAGGAAACTGGCCAA
ATTTCAGAGAAAGTTATCATTGGATTTAGAAAACCCTGTTGGAATCAAATGAAACCAATG
GATTAAAATTTAAATAGAGGGTACGGCTAGTATGGAAATTATGGGAACCAATATTAAAAC
TAGTATTAAAACTAATACTAAATGAAGTCTGGATGCTACAATAATTACAATCAAACTATT
CAGCCACTAAAAGCTGAAGTACCAAAGACTCTGTCTGCTGAAAACAATCAGCCATTAAGT
GGAGACCAATAAAACCAAACTCCCACTTCAGATTAAGCAAATTTGCAATAAAATTCGGCA
GAGGATCAATAATTGGAACAAAATTCTACAAAATCATGTCCAAACTTAAGATCAAGTTCC
CTTCCAATTTTTCAAAATCAATATCACTCTATGCGCAGATTTATACCTAGAGAGAAGTTC
TTTAAGAATCGAAAAATAGATCAGTAGAATAAAAAGAAGCAGCAAAACAGCATTCTTGAA
TTTATAGATAGTGACTATAATCAAATCTACCAAAAACAAAAAGAGCAGTATAATTTACAG
TTATAGTAGTAGGAATAGATACAATAAGCCTATTAATAGTAGCTATATAGACAAAGACTA
AATAGTATGAATCCTTAAACTAATGGAAATGGTAAAACTGGATACTAACCATATTAGAAA
ACTGAATATTCTTACCCGAATAGACTTCCAAGACTGTACTATTGA


>Contig20812.0.0.g27(protein)
MLSQDRHILDYLLQDFDHNEAPQNQDKLQAIKKPRKGPLVKKIKKPSIPDPYQTMKQLDK
MHINMPTYDEDPIEDFNENGSMQENHKSNGSLKREDLSRDLEQDHLDELEDEKSGSYNYQ
SNFQEDEYMIENLSQQIQQLLNEEDDDANRQNLFETHSQEIREIAEKERLKMLEEQKVNS
SENQVQPNQNDATSIIQQSLRKKGKCPEDIQQRIFQISKGSEYQKQEEKRNIQVKEKLEK
YLAKINRMSNNADSWNQLEVGIKYSKFPLKLQSSNKRTTFYWEQQLEVKRRIQKHRTELV
TERTWIHIDMDMFYAAIEIRDNLTLADKPVAVGEMNMIQTASYVAREYGVTSGLPGFIGK
RLCKDLIFVKPDKEKYQKEYAEIKKLLQDFDPLLECPSPDEFLLDVTQYIKTYNLDDDLG
RIFLGDKIRKLILQKTQLTASCGVACNKLLAKICSDFNKPDGLTFLQLNAVEISKFMDNL
PIKKLQGIGKVTEMIMNGLGIFNCKDIVVKAREIYINFTENVFDFLVKSALGIGKNLHDE
QTQIKKSLSVAESFKNINDYELLKNKVIELAKELAQKCVAEQLLGRTLTMEYKTKNLLTK
QKYTSNIQPYRQYSSSIYTDNEEELVNVSLKLFHQIWPIDGGMRMIGLKLINLMHKETGQ
ISEKVIIGFRKPCWNQMKPMDQNLNRGYGQYGNYGNQYQNQYQNQYQMKSGCYNNYNQTI
QPLKAEVPKTLSAENNQPLSGDQQNQTPTSDQANLQQNSAEDQQLEQNSTKSCPNLRSSS
LPIFQNQYHSMRRFIPREKFFKNRKIDQQNKKKQQNSILEFIDSDYNQIYQKQKEQYNLQ
LQQQEQIQQAYQQQLYRQRLNSMNPQTNGNGKTGYQPYQKTEYSYPNRLPRLYY