Identifiers and Description

Gene Model Identifier

Contig13920.0.g31

Standard Name

REV1b

Aliases

Contig13920_0_g31

Description

impB/mucB/samB family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004553091.0000198575659891e-106DNA polymerase IV / kappa
SGDYOR346W0.00000000009998509410508463REV1 SGDID:S000005873, Chr XV
from 981828-984785, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13920.0.g31(coding)
ATGAAATCAGGAGGCAGAGGCCGAAGTAAAAAAGCAACTTAAAATAATTAAGATTTAGAC
ACAGCAGCACCTCAATAACCTACAAAATCAAAAGCTACTAAAAAGGGGAATAGATATCAA
TCAGCGAATGCCAATGGGCATATTTAAAATCCCGAAACCCCTTAAGGTGGAGCTTAATTG
CTTTCAGATTTGAACAAACCTATAGGAGTGAAAAAGGGGCAAGGCGATAACAATCCAGGA
CCTGCTGGTGCTAATAGAGGCAAAAAACCTTTTTATAAGAAAAACTTCAACAATAACACC
GGTGGAAATTAAAACTATGGGAACATTAGCTACAATAACAACCAGGGAGCAGGGAAAAAT
TGGAATTAGAATTACAGAAAGCAATTTGACAGTACTTGTAATGGAGCTGAGGACGATTCT
TATAATTACAAAACTGGTGAAAAAGAGGGCAAAAAGTATTTCTATAAGAATAATTATGGC
AACTAGAATTGGAAAAACAATGGCAATGGTTAAAATTGGAACAACAATAAAAGTAACTGG
AATAAAAGTAGTAATGACACTCAAAATCCAAATGGCAACACCAATAATTAGCTAACTAAT
GATAGTGGCAACGGCTAAAATTGGGTACAAAATAAACGCCAGTATTTCGCTTAGAAATAT
TACTAATAAAAATCTTAAAAGTAGCCATAATACGAAAGTGCTACAATTACAAAAGAAAGC
CAATTTGATGACGAATTCAAGTACAAAAATCATCCAGAAAATTAGAAAATTAAACTGAAA
CAGGTTGATGAAGATGAAAGTGTTGATAAATATGGGTTTGGAGGCTCAATGCCCTATCAG
ACAATAGATTTCAACAAGAAATAGGTAAAAAATATTAAATAGCCAGATTAAAAGTAAGTA
GGAGGATATCAGTAAAAGCAGCTATTCGCTAAAGCCCCATTAAAAGGTTCAGATTCTAAG
GGATATCAGAAAAGCCATCAGTAGAATTAAGATTTAGAAGAGGATTAAGATATGCATTAT
GAATATGGAGGAGAAGATTTTTATCAGAGCAAACCCTCTAAAAATCAAAATGACAACGAA
GAGTTTGGTGAAGAGTATTACCAAGAGGATTTTGAATATGGAGAGGAAGAAGAAGAAGCT
GAAGAGGAGGCTGGTGATGGAAGTAATAAGCAAAGTTATGGCAACTACAGTAACAATAAT
AAATGCTATAACAAGTTTTAAGTGAATCACAAGGCAATTAACTACAAGAATTACGCTTAA
AAGTAGAAGATAATTGAGTAGATGAGGTAAGATGGTAAAAGTGCAGATGAAATTAAGATG
ATCGAGAATGAAGAGGACGACGATGGTCGCTAAACTTTCAATCACTTGCATGCATACAAT
TTTGGTATCGCAAAAGCTGGTATGGAAAACTTCAATGAGAATAAAGTCGATCAAATGCTG
AAGGAAAGTATCACAAATAAGCAATACTATATAACTCAAGAAGAAAAGATCGAAAAAGTC
GAAGCCAAAGTTGCAGCTTATAAAGCCAAAATTTAGTAGTACAGATAGAATACTTAACTC
TGGGAGAAAACTTAATAAGAAGTTAAGAGGAGACTAGAAATTTACAGAAAGGAGAGAAAC
ATAACTAGGACCTGGCTTCATGTAGACATGGACATGTTCTATGCAGCTATAGAGATAAGA
GACAGACCTGACTTGAAAGAAAAACCAGTCGCTGTTGGTGACTATAGTATGATTTAAACT
ACAAATTATGTGGCAAGAGAGTTTGGAGTAAGATCAGCAATGCCAGGTTTTATGGGTAAA
AAGCTCTGCCCTACGTTGGTATTTATCAGACCTAACAAAGACAAGTACCGTAAGGTATCA
GACACAGAATTCAAAGCTATCCTAAGAGAGTACGATGATAAACTTGAAAGTATTGGTCTT
GATGAGGCTAACTTGGATATCACTGATTTTTTGCAGAAAAATGGAATGGACTGTCCTGAG
GGCAGAATTTTTGTTGCTGAAAAGATAAGAGAACAAATTAAGACAAAGATGCAAATGACT
TCGAGTGTTGGCATAGCTAGCAACAAAATGCTTGCAAAGATATGTTCTGAACTTAACAAA
CCAAATGGGTAATCATATTTAGCTTTTGATGCTGATAAAATCGAGGAATTCATGAGAGCA
AAGAAAGTTAGAGATGTACCAGGGGTAGGAAGAGTTCATGAATAAGTTTTAATAGGACTA
GATATCAATACATGCGATGAGATTCTTAAGAAAGCAGCAGACATCTATATAAACTTCACA
GAAACTGCTTTTGAATTTCTTGTTAAAGCTGCAATGGGAATCTCAAGATGTTCTCATGAC
GATGATAGTGGGAATTTGGCGAAACGATCTATAAGTTTCTCAAAAAGTTTCAAAGTAATA
TCGAGATTTGAGTAATTCAAAGAAAAGATGGATAAGTTAGCAACTAATCTTGCTGAGAAA
TGTAACGAAATGAAGATCTTGGCAAGGACACTTTCGATTGAGTTTAAAACTGAGAAATTT
ATGCTTAAGCAAAGATCTTTGACTTTCAATTAGCATATTTGCCATAAGGATGATATAATG
AGATATGCAAATGAACTACTAAACGCAGTTTGGCCAGTTGAACCCTGCAGAATGATGATG
CTAAAACTTAACAATCTCAGAAACAGAACTGAAAAAGACTCAACTGAATCTCTTCTCAAA
GATGTAAAGAACCTTCAGTTTTTCATGGGCAAAGGGAGAAAGAAAGGCTGTCTTACAGCT
GCTGAGAGTACTGGAGTCGTGACATTAGAAAGCGGTCAGAAAACTCTACAATTTAACTAA
GCTATTCTCAATCAGCCTCCTGTTTAACCAACTGTAAGCGCTGTCATTTATCATGAAAGA
AAGAAAGAAAAGGAAGATAGATACAAGAAACTTATTGGGTAGCAAGACATCAAGAATTTC
TTTGGCAAACCTAAAAAGCAAACTAGCGAAGCTAATACAGAGTAATAACAAAATCAGAAT
AACAATGTTAAAAATGATTCTGGAAATACAAGCCAAAATAATGAGCAAATTCTCTAATAA
AAATTCAACTCATATCATGATAGTGAGGACGATGAAATATCTAGGAAATTTAATCAGATA
TAAAACGACGATGATGATTACTTGAAAGATATCATTATGGCTTAATAGCAGTAGAACATC
AATAAATCCAAGTAAAAATAGCAACTTACAAATCAAAACATACAGGACTTCCAGGACTAA
ATGAACAAAATATCATTCTTACAGAGAAGATAAAATCACTAGAGTGAGAACGTAGAAGAG
GAAGATATAGATGAGGATGATGAAGAGGAAGGAGAAGAATTGTAAGATAATCATCATGAA
TATGACTACGATGACTTCGATTAATAGCAGTAGTAAAACACTACTTTAGAAGGCACTAAA
AGCCTAACAATGGGCATTGGAGCACCTAGCAACCTGGATAATCTGCAATTTTATGATGAA
GAGGAAGAGATCGAGGAAGACGAGGAGGACATTGAGTAAGCCAATTAAAATGAAGGGATT
ATAGAAGGAGATGTGAAAGCTTCTGGTTAGGAAGAAAACAATAGCAGCAGTGATAATAAG
GATGAATAAAAGACAAATGATAAGAAATAACCTATGTGA


>Contig13920.0.g31(protein)
MKSGGRGRSKKATQNNQDLDTAAPQQPTKSKATKKGNRYQSANANGHIQNPETPQGGAQL
LSDLNKPIGVKKGQGDNNPGPAGANRGKKPFYKKNFNNNTGGNQNYGNISYNNNQGAGKN
WNQNYRKQFDSTCNGAEDDSYNYKTGEKEGKKYFYKNNYGNQNWKNNGNGQNWNNNKSNW
NKSSNDTQNPNGNTNNQLTNDSGNGQNWVQNKRQYFAQKYYQQKSQKQPQYESATITKES
QFDDEFKYKNHPENQKIKLKQVDEDESVDKYGFGGSMPYQTIDFNKKQVKNIKQPDQKQV
GGYQQKQLFAKAPLKGSDSKGYQKSHQQNQDLEEDQDMHYEYGGEDFYQSKPSKNQNDNE
EFGEEYYQEDFEYGEEEEEAEEEAGDGSNKQSYGNYSNNNKCYNKFQVNHKAINYKNYAQ
KQKIIEQMRQDGKSADEIKMIENEEDDDGRQTFNHLHAYNFGIAKAGMENFNENKVDQML
KESITNKQYYITQEEKIEKVEAKVAAYKAKIQQYRQNTQLWEKTQQEVKRRLEIYRKERN
ITRTWLHVDMDMFYAAIEIRDRPDLKEKPVAVGDYSMIQTTNYVAREFGVRSAMPGFMGK
KLCPTLVFIRPNKDKYRKVSDTEFKAILREYDDKLESIGLDEANLDITDFLQKNGMDCPE
GRIFVAEKIREQIKTKMQMTSSVGIASNKMLAKICSELNKPNGQSYLAFDADKIEEFMRA
KKVRDVPGVGRVHEQVLIGLDINTCDEILKKAADIYINFTETAFEFLVKAAMGISRCSHD
DDSGNLAKRSISFSKSFKVISRFEQFKEKMDKLATNLAEKCNEMKILARTLSIEFKTEKF
MLKQRSLTFNQHICHKDDIMRYANELLNAVWPVEPCRMMMLKLNNLRNRTEKDSTESLLK
DVKNLQFFMGKGRKKGCLTAAESTGVVTLESGQKTLQFNQAILNQPPVQPTVSAVIYHER
KKEKEDRYKKLIGQQDIKNFFGKPKKQTSEANTEQQQNQNNNVKNDSGNTSQNNEQILQQ
KFNSYHDSEDDEISRKFNQIQNDDDDYLKDIIMAQQQQNINKSKQKQQLTNQNIQDFQDQ
MNKISFLQRRQNHQSENVEEEDIDEDDEEEGEELQDNHHEYDYDDFDQQQQQNTTLEGTK
SLTMGIGAPSNLDNLQFYDEEEEIEEDEEDIEQANQNEGIIEGDVKASGQEENNSSSDNK
DEQKTNDKKQPM