Identifiers and Description

Gene Model Identifier

Contig20425.0.g74

Standard Name

REV1a

Aliases

Contig20425_0_g74

Description

impB/mucB/samB family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR419W0.0000000000010000211161514907RAD30 SGDID:S000002827, Chr IV
from 1303174-1305072, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20425.0.g74(coding)
ATGGATGCCTATTACGCCTAAGTGGAAATGAAACTCCATAATCTTGATCCTAGTAAACCT
ATGGGTGTTATATAATGGAATTCTTTAGTTGCTCTTAATTATGCAGCTAAGGATATGGGA
GTTAAGAGAAGTATGAGACATTTTGAAGCCTTAGAAGTGTGTCCTGACATCACATTTGTG
CACGTTGCCACTATGATTGAGAACCCAAATCATTAGAAAAGTGTGCTAGATAAAAAGCAA
AATTAGGAAGCTGTTGATAAGTAAATATCGAAAATTGAAGAGACAAAATGCGGGACAAAT
TAAAATTAAAGCACGGAATGTAGCGATGATTAAATTGTTGATTTAATGGATTTACTTTTG
AATGATGAGCCAGAATAGACTATTGAGACTCTCATTCCCTCAAGTGTGTTAAAGGTATAA
TGTCTGAACAAAGACTCAAGTATCCCAGCTGTTAGAAGATTCAGAATTGAATAGCGAGAT
AAAGAATCGTAAAAAGTCTCGTTGGCTAAGTATAGAGAGGAAAGTAAGAAAATCTTTGGA
ATTGTACAGAGATACAGTTAGCTTGTAGAAAAAGCGTCATGTGATGAGGCTTATGTAGAT
GTAACTAATCAAGTCAATTTAAAATATCAATAAGAGCATGATAACATTTTTCCTAAGAAT
TATACAACAGAGGCATGGTGCAATAGTTACTTTATGAGTTATCCTAAGGGAGAGGGTCTA
TTTATTCCAGAGACTGAATATGAAAAGAAGCTGTTTATAGCTAACTAAATTGCGTATTCC
ATCAGATAAGATATTAAGAGAGAATTATAATATAATGCTTCATGTGGAATATCTCATAAC
AAAACTATGGCTAAATTGGCGAGTGCAAATAACAAGCCTAATGCTTAAACTGTTGTCCCT
ATAAGATATATGAAACGGGCTATGAAGGATGTAAAAATTGATAGCGTTCGTTTTTGCGGA
GGTAAGGTTGGTGAATCACTTCATAATGCAGGATTAACAACGATGGGTTAGATTTAAGAA
ACATCAATCGAAGATCTTTAACTAATTGTGTCTCAATCAACTGCATAATGGATTAAAGAT
TTGAGTGATGGCATATGTTATGAAGAGGTTAAGGAGAGAAATCTTCCAACAACTGCCAAT
GCAGTTAAGACTTTTAAGAAAGTTTATAATTTCTCAGATTTAGAGAAATTAATTGGATTG
GTTGTGCTTGATTTAAGCATTAAAGTGCAGGAAGCACTTGACAATTTAAACATATTTCCA
GTGTCTTTTCAGATTGGTTTCAAGGATAACTTAGATGGTAATCATAAGACTCGTAGGTTT
AAAATGATCTCCCTTGACCAATTCAATAATGACAAAAGATGCTTGACTAATCATGCAACA
GCACTTTTCAAGTAATTTGAGAAAAACATTCTCCCAGCAACTTCAATTTCAGTTGGGGTT
ATGAACTTCAAAAATCTTTCTGAACTCAAAGGCGATTAAACCACTGCTCTTAATAAATTT
TTTAAACCCATCAACAACGAAGAGTATAAGGAAAAGTAAAAAATATAGAATGAAAAAATG
AGATAAGAGATTAAACAAAATAAAATCAGTTAAACAGCTGAACCTATAACCAAAGTAAGT
GAGAAAATAGACTCCAGCAACTAATTTAGTAAATCATCTTTGGCAAGCGATGTTACAAAG
AAGAGATCAAACGCGACTAAAACTGAAAAATCCCAAGATATTAAGATGAAAGATTAAGCT
AAGAAATAGAAAAAGTATTAAGTAAAGAGCAATTTATTAACTTAATTCTTTAAAGTATCA
GAGAAAAGTGATAGCAAATGA


>Contig20425.0.g74(protein)
MDAYYAQVEMKLHNLDPSKPMGVIQWNSLVALNYAAKDMGVKRSMRHFEALEVCPDITFV
HVATMIENPNHQKSVLDKKQNQEAVDKQISKIEETKCGTNQNQSTECSDDQIVDLMDLLL
NDEPEQTIETLIPSSVLKVQCLNKDSSIPAVRRFRIEQRDKESQKVSLAKYREESKKIFG
IVQRYSQLVEKASCDEAYVDVTNQVNLKYQQEHDNIFPKNYTTEAWCNSYFMSYPKGEGL
FIPETEYEKKLFIANQIAYSIRQDIKRELQYNASCGISHNKTMAKLASANNKPNAQTVVP
IRYMKRAMKDVKIDSVRFCGGKVGESLHNAGLTTMGQIQETSIEDLQLIVSQSTAQWIKD
LSDGICYEEVKERNLPTTANAVKTFKKVYNFSDLEKLIGLVVLDLSIKVQEALDNLNIFP
VSFQIGFKDNLDGNHKTRRFKMISLDQFNNDKRCLTNHATALFKQFEKNILPATSISVGV
MNFKNLSELKGDQTTALNKFFKPINNEEYKEKQKIQNEKMRQEIKQNKISQTAEPITKVS
EKIDSSNQFSKSSLASDVTKKRSNATKTEKSQDIKMKDQAKKQKKYQVKSNLLTQFFKVS
EKSDSK