Identifiers and Description

Gene Model Identifier

Contig13888.0.g67

Standard Name

RECQL4b

Aliases

Contig13888_0_g67

Description

Helicase conserved C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00271 ) Helicase conserved C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012052303.0011595823640496e-94ATP-dependent DNA helicase, Re
cQ family protein
SGDYMR190C3.0009061039838537e-46SGS1 SGDID:S000004802, Chr XII
I from 645258-640915, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13888.0.g67(coding)
ATGAGTTCTCTTATTAAAAAGTTCCAAGAAAAAGCTTAAGCTTCTGGCATAGCTCCAGTT
TAACAAACAACTCAACCTATTCAAAAGCTAAATACCACCTAAAGTATGATTGGAATGGGG
GTGAACAGATCGAAATCCCTGACACAGCTTCAAGGCTAATAGAATCCCGCCATAATGAAC
AAATAAAGTTTTGCTCACATATAAAGTTCCAATTATGGTCAAATCAAGCAGGGAAGTGGG
ATTAATTTGTAAAATTAAAAGGTGACCAATGGCGTTGTTTCAACAAGTGGAAGCAGCATT
CCAAACATCTCCCGCAAGTCAGTAATTTCTCAAGAGCACAACCAAAAGCCCAGTTAATAA
AAATCTGCCCTCCCCACCAAGCTTCACATACAATCCAAAGATCTAGCTAATAAATAGCAC
AAACCTAAATTCAATTTAGACTAAGCTATGTTCACTGGTAAGGATGAGTTACAAATGGAG
AAAACTGGGCAGCTCATAATTGATAGAAGTATTTAAAACCAGCAAAAAATGTTTGAGAAG
ATGCTTGATCAAGAGATGGCTAATGACAATTTATTTATGGCTGATAATCATGAAAAAACT
GCAATTTCTTCTGGAAGACTGTCTGTGGAAGATGCCCTGGCTAGATGCAATAAAAAAATT
GCTAGTGCTCAAGCTAAGATGAGCATTGGTTCATTCGGTAACAAACAATAGTAGTAAGCT
AAGGTACCACCCTTCCAAAGCTATCACAATGCTGATTAATTGATTGCTACAGCTGACCAC
TCAGATATTAAACATACCTAGAAGACTCTCTTCAACAACATGGAAAACACTGACAGCACA
AACATGACAAGTTCTGGCATGAGACCAAGCATTTCTGGCAACGGAAATAACTAACTAACA
ACACCAATCGACACCTATAAAGCTTCTCAATTCACTCTGAATGTCCTAGGTGACAGCAAC
AACCAAGATGGCCTCAAAGCTGGCAAGAAATCTCATGCTACACCAGTTGCTAGTTAATTC
AATTCGAATGAGTCAAAGATGACTCGCCTTCAATCCACAGATGAAGAGGGAAACAGACAG
AGCATCATGCCTGGCAGACCATCCATCTCAAATGCAGGCTCTACAGTTGCTACTAAAAAA
GCACCAAGTGTAAGAAAAGCTAAAGCTACTGCTACTAAGAATAAGGTACCCAAGGAGTTT
GATGATAAAGTTGAATCTTAAGAAGCAAAGAAAGCCCCAAATATGCTTGAGAAAATGACC
ACTCAAATAGAAAAGCTAAAAACTTCAAAGGCTATCCAAAAGTAACAAGCAAGTTTGAAC
CCAGACCGCCAAAACCGCACTAATTTCGTGAAAATGAACTTGAAAGCCTACAAACCCCGT
ATGAGAGGAGGTGCCTTCCAGAACAAGATGATGGCCAAGAAGAAGAACTAGCTGAAGTTT
AATGACAGAATCAAGAGAAAGATGCAGATTGAGGCTGCTAAGAACAGAGATCAGGTCAAT
GCCTTCGGAGGCCTGGGTAAAGTTGGCTTGGAATACGCTGGTGGCAATCCAAACCATAGA
ATCGATGATATCGGTAATCTAGTAGATGAAAATGGTAATTTGGTTGAGGATTTAGTACCA
GGCTTCAGTACTTCTGCCTTGAAATATGTTAAGAAAGTAGCTAAGACTCTCAGTGAAATT
GATGAACAAGAAGATAATGGTGATGATGAGCAACTTCTTGATGGAGATGAAGAAATCAAG
CACCTACATAAAATAGATGAAGAACTCAAGGAAGAAGAAGATAAAAATGAGGAGGAGATA
AAGGAAACTGAAGAACTTCCAACTGATTTCGATATTCCACTCTATAAAATTCCTGATAGC
GATGAGGAATACACCAAAATCCTGAAAGACAAATTCGGGCATGAAAGTTTCAGAGCTGGT
CAACTAGAAGCCATCAAGATCCTACTGGTAAAGAAAGAAAACGCCTTGGTAGTCCTTGCA
ACAGGTGGCGGTAAATCTCTCGTCTACTAGTATGTATCTATGTTTATGAATGGCTTAATT
ATAATAGTCACTCCCCTAATCTCACTAATGACTGATTAATTAGGAAAATTACCTGATTTC
CTACCAGGTGCTTCTTTGAATTCACATTAAAACTACCAACTTAAGAAGGAAGTAATTAAA
GCTATTCAAGATAAGCACATTAAAGTGTTGTTCATCTCCCCAGAAAAGTTCTTTATGGAA
GATTTCAGCAAATATAACCGTAAGATTGCTATGGTATGTGTGGATGAAATTCATTGCGCT
TCTGAGTGGAGTCACAATTTCAGACCAGCCTATCTAAAACTCCACGACATGATAAAGGAG
AAAGTTACCAGTCAGAAAGATTCCTGCGTAGTCCTTGGTTTAACAGCAACCGCCACCAAA
GCAACCCAGAAATCAGTGTGTAAAATCTTCAATGTTCAATATCCAGAACACATCGTAACT
GAGCCTAATCTCTCCAGAATGAATTTGAGTTTGAGTATCACAAGAGATACTGATAAACTT
AAGAGTTTAATGCAATTAATGAGTTCTGGCAGCTTCAAAAAGCTGACTTCATAAAATGGC
ATTAATAGTAGTGCCTATCATGCTGGTAAGTCTGATTAACAGAGACAAATCATTCAGAAG
AATTTCATCAATAACAATATTCGTGTATTGGTTTGCACAATTGCTTTTTCCATGGGTATC
GATAAATCCGATATTTAATCAGTTATTCACTACGACATGCCCAAATCCATCGAGAACTAC
GTGCAGGAGATAGGTAGAGCAGGTAGAGATGGAAAGCTTGCCAGGTGTCACATGTTTTTG
AACAATGAAGACTTTTATCTTATTAGAAGGCTTATATTGACTGATTTACTAGACAACCAG
AATGCACTCAAGTTGACCAATAAAATCATTGTGGAGTTTAAAAGAGCTGTGATGAAGATA
TTGAAGCCAAATTTAATCAAGAGTAAAAAGAGAAAGTTAAATAAGGTATCTGGCAGTGAA
GAAGATCAAATGAATAATGGTATGATTGAAGAGTTTGAACATGAAGAAGAACTTAAGAAG
TACTACGAGAAGCAAGAGGATGGTGTTATGAAAATCTTCCCAGAATCAATTTCAGCAATT
GAGAACCCAAATAGACTTTATCTCTTTTTAGATGTCAAAGAGACCCTATCACTCCTAGAC
CTGAAAAAAGAAGTCGTACTTACTATGCTTAACTCACTTGAAAAGACTTCAGAGGAAAAG
AGATTCTTCTCTTTGGAAGGAGTCCTCCCAGATAAAATTGGCATGAGATTCCACTCTAAA
CGTCCAGAGCAGATGGCACTTGAGAATCCATTCATTAAAAAATTCCTTGAAATCGCAAAA
GAGCACTAGGGAGTCTATAATGTCAGTTTGTAGAGACTCGCTTATGAACTTAACATGAAT
CCTTTCCACATACCAAAAATATTGTACTCAATGCAAAGTACATAAGGCAACGACATTTCT
TATGACACTGATAATGAAAGTTTCGTGTTGAAAATCTGTCACATCCCCAGTGGCGGTCAG
ACTTTGGAATTAAGCTAGGATATGTTGAAGGAAACCAGGAGAATCGAAAGAAATATGGTC
TAGAAACTCAACTGCATGTATTTCGTGGCAAGAAGAGTGTCACTGATTAATGTAGATGTT
ATGTTAAAGAAAGAAAAACAAGAAGCTGATAATGGACTTGAAATGTACAAGGGCTTCTCC
AACCAATTGAATGACTTGATAAATCTATACTTTAGCATTGAAAACGAAGATGACATGGAA
GTGTAAGTAGCAGGTGATGAGGAAAAACGTAATGAAATGATGCCACTTATTTACATAAAC
TCACATCGTGACAAAGCATCAGTAGAGAGTGAGATTAAATCTTTATTGAAAGAATTCCAC
GAGCAAAGCTCAAGTTTGGAGGCAAACGATAGACTGAAAGCTCTCGACGTTGTCAAAATT
CTAATGGGTATCTACAGTGACAAGCCAAGCATCAAAAGATACGCTAACAATGGCAAAGTA
TGGGCTAAGTACTAAGACTATGACTATGTGGACTTGCAAAAAGTAGCCACTTTAGCTGTT
AACTAATTCTATCTTGATTAAGTTAACGGAGTAACTACTAACAATGAATAAGCAGATAAT
GGGAAAAGAAGAAAAGTTAACAGTTGA


>Contig13888.0.g67(protein)
MSSLIKKFQEKAQASGIAPVQQTTQPIQKLNTTQSMIGMGVNRSKSLTQLQGQQNPAIMN
KQSFAHIQSSNYGQIKQGSGINLQNQKVTNGVVSTSGSSIPNISRKSVISQEHNQKPSQQ
KSALPTKLHIQSKDLANKQHKPKFNLDQAMFTGKDELQMEKTGQLIIDRSIQNQQKMFEK
MLDQEMANDNLFMADNHEKTAISSGRLSVEDALARCNKKIASAQAKMSIGSFGNKQQQQA
KVPPFQSYHNADQLIATADHSDIKHTQKTLFNNMENTDSTNMTSSGMRPSISGNGNNQLT
TPIDTYKASQFTLNVLGDSNNQDGLKAGKKSHATPVASQFNSNESKMTRLQSTDEEGNRQ
SIMPGRPSISNAGSTVATKKAPSVRKAKATATKNKVPKEFDDKVESQEAKKAPNMLEKMT
TQIEKLKTSKAIQKQQASLNPDRQNRTNFVKMNLKAYKPRMRGGAFQNKMMAKKKNQLKF
NDRIKRKMQIEAAKNRDQVNAFGGLGKVGLEYAGGNPNHRIDDIGNLVDENGNLVEDLVP
GFSTSALKYVKKVAKTLSEIDEQEDNGDDEQLLDGDEEIKHLHKIDEELKEEEDKNEEEI
KETEELPTDFDIPLYKIPDSDEEYTKILKDKFGHESFRAGQLEAIKILLVKKENALVVLA
TGGGKSLVYQYVSMFMNGLIIIVTPLISLMTDQLGKLPDFLPGASLNSHQNYQLKKEVIK
AIQDKHIKVLFISPEKFFMEDFSKYNRKIAMVCVDEIHCASEWSHNFRPAYLKLHDMIKE
KVTSQKDSCVVLGLTATATKATQKSVCKIFNVQYPEHIVTEPNLSRMNLSLSITRDTDKL
KSLMQLMSSGSFKKLTSQNGINSSAYHAGKSDQQRQIIQKNFINNNIRVLVCTIAFSMGI
DKSDIQSVIHYDMPKSIENYVQEIGRAGRDGKLARCHMFLNNEDFYLIRRLILTDLLDNQ
NALKLTNKIIVEFKRAVMKILKPNLIKSKKRKLNKVSGSEEDQMNNGMIEEFEHEEELKK
YYEKQEDGVMKIFPESISAIENPNRLYLFLDVKETLSLLDLKKEVVLTMLNSLEKTSEEK
RFFSLEGVLPDKIGMRFHSKRPEQMALENPFIKKFLEIAKEHQGVYNVSLQRLAYELNMN
PFHIPKILYSMQSTQGNDISYDTDNESFVLKICHIPSGGQTLELSQDMLKETRRIERNMV
QKLNCMYFVARRVSLINVDVMLKKEKQEADNGLEMYKGFSNQLNDLINLYFSIENEDDME
VQVAGDEEKRNEMMPLIYINSHRDKASVESEIKSLLKEFHEQSSSLEANDRLKALDVVKI
LMGIYSDKPSIKRYANNGKVWAKYQDYDYVDLQKVATLAVNQFYLDQVNGVTTNNEQADN
GKRRKVNS