Identifiers and Description

Gene Model Identifier

Contig17273.0.g45

Standard Name

RDR4

Aliases

Contig17273_0_g45

Description

RNA dependent RNA polymerase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008531501.9992362000979228e-56RNA dependent RNA polymerase f
amily protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17273.0.g45(coding)
ATGTTAAAGTGTCTTGGTTTGGTCCTCCTAGATCCTTTTGAATATGACATTGACTTAGAT
GATAGAGTAAAAACAAATTACAGATAAAATAGAAAATTTTAAAGCAAATTTACTTAGTCT
GAAGGAAATTTAGCAAGCTTTTCAATAGGTGCAGCATCTCAAGACAACATATTTACAAAA
ATATTCCCAAATATGTACATTGATGATCTGCAAGATGGATTTAAGTTCGAAAAAATAATA
ACCTTTCACAAGACTTAAAATAGATAGGATTAGACCTTTACAAAATATCCTAAGAAATTC
CAGATTCATTTTCAAATTAGTGACAAAAAACTAGATATGTCTTGGAGAAAGATGAATGAT
GAAAAGTACAACAAATTTTCTAAATATTTCATTGAGATAGATATGAAAAATATTGAAATA
ATCGAATATATTCTTCAAGATATTGGCTAGGATAACTCAGTAGTACAAATGATGATGAAG
TTATCAAGTCCTTGTAAATTCTCTTCTATTGATGAAAATCAAAAATACACACAAATTCCA
TCACTTTATAACTTTAGCGCTTTTTTACTGGATTGTCCAGTATAAGATAGCGAATACTTG
GATTAGTTGAGACTCAAATGCTATTTTATCTAAAAACACTAAGCCTAAACAAGCTTTCAA
ACTAACTTTTGTGTGATGCAAATGGTTTCTGCCAAGTTAATTGATATTTTTAGTGTGAAA
GTAGAATTTATTGAATTTTTGTAAACTATCAATAAAGAAAATAATTAGTAATATGGAAGA
AAGTTTAGGCATTAAATAGAAGACATAATACAAACAGCTTAAGTAGGAGCTGATTTTGAA
GATTTTAAAAAGATAGGTGATAAAGTATAATAAACTATTCTTAAAAATTGGGATAGATTT
CACTAAGACATTCTTAAAATGAAATTACCAGAAAATGATGATGGAAAAATTGAAGCTTAC
AGCTTAACTATAACTCCAACATTTAACATCTATAATCTTAACTCTTAGTAACTATCAAAT
GTTATATTGAGACAAAATTAAAACTACCATGATAAATTCTTGAAAGTTGATTTTAAAGGT
GATGATCTCGAGGATGCTGGATAAATCTTGCAAAGTAAATACGGATTTAAGTAAGGCAAG
CCAATAAAACATAAGAATAGTTTATCGAACTATGTCTGGAAACCAATCAGTGAGGGAATA
AATATTCTACATATGAATTACTAATTTCTTGGAAATTCAAATTCCTCATTAAAGTAACAC
ACAATATGGATGCTTAATACAAGTTAATTTGAGGATAAATGTGATAATGTAGTCAGATTG
TACAATGGTATGGAATTACTGTAATAGATTTAAGAAAGCTTTGGGCATTTGCCAAAAGTG
GTAAAATCTGAGAACAAAGAATTAAATAAGGGAATTACACTTCACACACTTGCCAGAGCA
GCATAGCTTTTTTCAGGTACAAGACACATTTGCGAGCTGAGAGCTGATCAAATAGAGTAT
ATCCCAGATATCATTAAAAATGGGAAAAACTTCTCAGATGGAAACGGATGTATTTCTTAA
GAATTGGCCAATAAAATAAATGCTATCTACAACCTTTAAGATTGTTCAGCTTATTAGTTT
AGACTCGGGGGTTGTAAAGGTACGTTGGTTGTAAATTAAGAGTTATAAGGGGAAAAAATT
TAAATAAGAAAGAGTATGAAAAAATTTGAGAATTCTGATACTTCTTTGAACATTGCGAGA
TGCGCAACACCCAGTTAAGGATTTTTTAACAGACAATTAATCTCCTTGATCGAAAATTAA
GGAATCATATTTGAGGACATCGAGTAGATATTAGAATCTTCGGACTAATTAAAATTCATA
AATTAAATCAACAGCTTTGAAAACACAATAAAAGATGAGGATTTAATTTTTTCTTAATAA
CAAGCTAAAATTTCAAATTTAATGCTCACAAATACTCAAAAAGAATTCATAAACTATATT
AGTGAGTCAGGCTAATAGATGTTTAAGACATTCGTTGAAAAGAGAATGGATGTTCAGTCA
GATCCATTTATTAAAAATTTATCGAAGCTACTATCACATTAAATTACATCTCAAATCAAG
AATAAAGGCAGAATACCAATTAAAGACTCTGCAATTTTGATTGGAGTAGCGGACTACCTT
TAAGTTCTATAGCCAGGTGAAATATTTTTGCAAGTTCAAGATCCTGATATTAATGAAGAA
AGTAAAGATATTTATGAAGTTATAACTGGGGATGTAATTATCACAAGAAGCCCATGCCTC
CATCCTAATGATGTCATGAAAGTTAAAGCAGTAAACTGTAATTAGTACAAACACTTAAAT
AACGTAGTTGTTTTTTCTGCTAATGGAGATGAGCCTATTTAATCTTAATTAGCTGGGGGT
GATCTAGATGGAGATGTGTTTCATATAATATGGAATGAGAGATTAGTTTCTTAATTTACA
CCATAATTTTTAGAGAAATAGAAGTTTGATAGCAAAAGAATTGTTGGTTATTAAGCAAAA
TATACTTTAATACCTTAAGAAATAGCTGATAGCTTACTACATTTCTTTAAGAACAACATT
TTAGGTAAGATTGACAGTCTGCACTTAGCTATTTGCGATAAGTAAAGTCCAAATTCACAA
CATGCTTTGTCCACAGAATTCCTACATTAATAAGCAGTAGATTTCTAAAAACATGGGTGT
AAACCAGATATAGAGGAATATCATGAAATTAGAAATGAAGGTCTTGATAATTAGATGTTT
CCTGATTATATGCAATCTAAATCACAGGATTCTTATGCTTCATAAAAGATAATGGGAACT
ATTTATAGAGCATTTGATATTCACTCTGATTTTATTAATTATACAGATGAAGATTTTTAT
AGTTCAATATTGGGTAACTATGAGATCAATTAGAGTTTAATTACAAAACTACCAGAATTC
ACTGAACATCTCTGCAATTTAAATGAGATTGTTGTAAAACCAGTTATTTAAGAAATAAAA
GACATTATGATTAAATTTCATATACCTACAGAAGCTGAGTTACTATGTTCTATAGAGACA
TAAAACAGTAAAAACGAATATTAAATTAAGTAATATGAGAGAAAGCGAAGTTTAATACAA
ATTAGCTTAAATGAAGCGATTAACAAGTATTAAGAAGTCATCTTGTCTTATGCTAATGAA
AAACAAATTGTAAATGGGAAAATAATTGCTCAAGCAATCTACTACATTACATATTTCAAT
TAGAATAAGATTGATTACTCATTGTTAGATGATGAAAACTATAGCAAATTTATTGCTATT
AAGATGCAAGAAGAAGAAAATGTTATGAATGAATAGCAGTACTAATAAGTTTCAAATCTA
GGAAAATACAAGAAAATGATGGAGAAGATTAGAAAAGGAAATTAATAACATTTGAAAACA
ATTTTATAATTCAAGAGATTCTTTTGTGTACCCTGGTTGATTTGTCATGATGACTTATTA
TGA


>Contig17273.0.g45(protein)
MLKCLGLVLLDPFEYDIDLDDRVKTNYRQNRKFQSKFTQSEGNLASFSIGAASQDNIFTK
IFPNMYIDDLQDGFKFEKIITFHKTQNRQDQTFTKYPKKFQIHFQISDKKLDMSWRKMND
EKYNKFSKYFIEIDMKNIEIIEYILQDIGQDNSVVQMMMKLSSPCKFSSIDENQKYTQIP
SLYNFSAFLLDCPVQDSEYLDQLRLKCYFIQKHQAQTSFQTNFCVMQMVSAKLIDIFSVK
VEFIEFLQTINKENNQQYGRKFRHQIEDIIQTAQVGADFEDFKKIGDKVQQTILKNWDRF
HQDILKMKLPENDDGKIEAYSLTITPTFNIYNLNSQQLSNVILRQNQNYHDKFLKVDFKG
DDLEDAGQILQSKYGFKQGKPIKHKNSLSNYVWKPISEGINILHMNYQFLGNSNSSLKQH
TIWMLNTSQFEDKCDNVVRLYNGMELLQQIQESFGHLPKVVKSENKELNKGITLHTLARA
AQLFSGTRHICELRADQIEYIPDIIKNGKNFSDGNGCISQELANKINAIYNLQDCSAYQF
RLGGCKGTLVVNQELQGEKIQIRKSMKKFENSDTSLNIARCATPSQGFFNRQLISLIENQ
GIIFEDIEQILESSDQLKFINQINSFENTIKDEDLIFSQQQAKISNLMLTNTQKEFINYI
SESGQQMFKTFVEKRMDVQSDPFIKNLSKLLSHQITSQIKNKGRIPIKDSAILIGVADYL
QVLQPGEIFLQVQDPDINEESKDIYEVITGDVIITRSPCLHPNDVMKVKAVNCNQYKHLN
NVVVFSANGDEPIQSQLAGGDLDGDVFHIIWNERLVSQFTPQFLEKQKFDSKRIVGYQAK
YTLIPQEIADSLLHFFKNNILGKIDSLHLAICDKQSPNSQHALSTEFLHQQAVDFQKHGC
KPDIEEYHEIRNEGLDNQMFPDYMQSKSQDSYASQKIMGTIYRAFDIHSDFINYTDEDFY
SSILGNYEINQSLITKLPEFTEHLCNLNEIVVKPVIQEIKDIMIKFHIPTEAELLCSIET
QNSKNEYQIKQYERKRSLIQISLNEAINKYQEVILSYANEKQIVNGKIIAQAIYYITYFN
QNKIDYSLLDDENYSKFIAIKMQEEENVMNEQQYQQVSNLGKYKKMMEKIRKGNQQHLKT
ILQFKRFFCVPWLICHDDLL