Identifiers and Description

Gene Model Identifier

Contig1272.0.g12

Standard Name

RCOR1a

Aliases

Contig1272_0_g12

Description

ELM2 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1272.0.g12(coding)
ATGATTATTATTATTATATCATATTTATTAAACATACCTTCTACATCACTAACAAATATT
TTTTTGACCTTTCTTACAACCAGTGCAGCAAGGTAAAAAGTATTCAAGAAATCAAAGACA
ATTTGCAAGCCCAAGAAAAAGCTCCCAACCTTGATTGACTTGACCATCAGCTCAGACGAG
GATGAAAAGTCGGTCATCACTATACACTCCGTCAACTCAGATCTGCCTGAAAACATTAAC
AATCTTGACTCAACTTAGTCCACAGCAGAAAATAGCGATAGTACCTAGACATCTTTACAT
TCAAGAAGATCAGCAAGTCCTGAAAAGTAACCCTAATAGCCCTAAGAAATACTAAATGAT
ATGACTGTTGTTGATCCATTAAGTTAAATAAACTTCACTGTGAAAAATATTCAAGCCCGA
AGATAAAAGAAAGCTCAAAGACTAAACTGCATTCGAATAGGTTCTTTTTATCAAGCTAAA
ATTCCTGAATTCTAAAACGTTATCTGTATAAATAACTCTGAGCTCAAATAAAGTGATTAA
AAAATAGACTAATAGATATTGTGGGATCCATCTAAGATATCAGATACTAATTTAGAGAAT
TATCTACAACATGCTAAATAATATCATCCTACAGATATAAAATACAGAGAAGATGTGGTA
CTAGACTTCTTGGTAGACTAATAATATAACTCGTAATCGCTACTCTAAAATATATAATTG
TTCTAATAACTGCTTAACTATTATGTGAGAATAAGAGATTCTGCAAGACTAACTAAAAAG
ATTGTAAATAAAGATGAAGATAACTATAATAAGAGATATGGAAGATTTTGA


>Contig1272.0.g12(protein)
MIIIIISYLLNIPSTSLTNIFLTFLTTSAARQKVFKKSKTICKPKKKLPTLIDLTISSDE
DEKSVITIHSVNSDLPENINNLDSTQSTAENSDSTQTSLHSRRSASPEKQPQQPQEILND
MTVVDPLSQINFTVKNIQARRQKKAQRLNCIRIGSFYQAKIPEFQNVICINNSELKQSDQ
KIDQQILWDPSKISDTNLENYLQHAKQYHPTDIKYREDVVLDFLVDQQYNSQSLLQNIQL
FQQLLNYYVRIRDSARLTKKIVNKDEDNYNKRYGRF