Identifiers and Description

Gene Model Identifier

Contig20936.0.g51

Standard Name

RCO1b

Aliases

Contig20936_0_g51

Description

PHD-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002957500.0000000008996637801615584AT hook motif family protein
SGDYMR075W0.0000007997233352734267RCO1 SGDID:S000004680, Chr XII
I from 413982-416036, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20936.0.g51(coding)
ATGCTATTTGATGTAGAGAGATATGTGGCTGAGATGGAGGATCTCAGAAAGATCTAGCAA
CTAAAACCCCCTAACAATAAGGTGCCTGCAGTTAATTTATCTAAGTTATCATTTGATAAG
AAAGTAGCTCCAATTACACTTGACATTAGATTTGGAGATAAATTCATTTTGAGAGATAAA
TTTGATTGGGACTTGATGGAGCCTAGATTAAGACCATAGGATTTTGCAAGAGCTATGTGC
AATCAATTGCCATTCTTCAAGTCTGACTAAGAGAAGGATGTAGCTATTGAAAAAATGAGT
AATTCCATTCTGGATTAGATTTAAGCACACATCGATAAAAATACATTCTTCCCAAGAGTA
AGATTTGGTAAAAAAGAGGAAGATACAATCGCAAACGATTAAGTCTGTGTAAATTGTGAT
TCTCTCTTACTGAATTCAGAGACTTGTGCTCACTGTGGATTTTAGTATGAGAAGAAGCCG
GGTCCTTAACCTGGTCCAGGAACCCAAATGCCAGAATCTATGAAAAATGAAAGAAAAGAA
GGAAATCAGAATAAAATTGATATTCAAGATGCCTTTAAAAAACCCGCCAATATAGGTTTA
GAACAAAAGAGCTAAAGAATATAAGAGAGTAAAAAATTGAACTAAGATGATTAAATATAA
GAGGAGCAACCAGTTTAAGTCATTCATGTATTTAAAGTCCCTGAAAATCCAATCGAAGGT
CAAAAATAAAGACCATAAACAAACACTAACCTCAGTTGGAAAGATAGACTTACAGGGGAT
TATGTGTTCTCTGGTAAAGAAAAGAAAATATGCAAGAAATGCAACGAAGTGAATCCATTC
TTTAAGAATGAATGCCAGAAATGTACCTATAAATTTCCAAAGACAAGAGGGTTGAATAGC
AGCTTAAATGCAGATAATTATACCTTATATTTCTGGGACATGCTTCACTCTGAGCCAATT
TTTTCTTCATTATCAAAGATTAATGACTACTTGCAAGAGAGCGATTTCATTAGTGTTAGA
GATCTGTACAAGAAAATAAAGGAGATTTTGACATAGCCAAACACTGAGAGAATCTTCGAC
ATAACAGACATTCAACTATTGGAATTACATGACTCTATCGATGAGAAATTTGAATGGTTA
CTCACAGACAATGAATTGACTGATAGAATCTTTAATGATGCAACTGCTTAAAAGACTAAT
AGGAAGAGAACTAAGCAAGTTTACTATAACTTCAAGGATGCTTAACAAGTTCATGATAGA
AAAGTATTAGGCATGGAGGATTTTTAAAGTAATAACTTTCAAAACGACGATTCATTTGAA
AACCCATATAAGAGGCTTAAAGCAGGGAATGAAAATTACTAGTAAATACAAAAGCAAAGA
CCACATAATTTCGAGTCAGTTAAAATGCAATCCATCATCTCAAATTACAATTTACTTTCA
CAAATGGGCTTCTTAGAATAAAGTGTGATACAAAGTGAAACTATCAACAAATTAGTAAAT
GAACAGGAGGAGATTATTTCAAGCTTGATAAAGAGAAGAGGAAGACCTAAGAAGTTTGAC
TTGACTTATGAAGATATGCTTAATGTTGAAAAATGGGATGATTCTAAGTTAGTTTTCTAA
ACTGGGTTACCGGGTTTAGGAGGGGAAAAGGATGAAGATGGCAATGATTAAGGTGGTGCA
CAAGGTGCTGGAACCTCAACTGGAACTAAGAGAAATGTTGATTTGAATGCTGATGTTTGT
GGTATTTGCGATTTACCAGGAAAGCTGATTTGTTGTGATGACTGCCCCTCAGCTTTTCAC
GCAGATTGCCTAGGGTATGAGAAGTAGTGCCCAAGAGGTAAATGGAAGTGCTACTTTTGT
AAAGTTATAAAGTATGGAATAAGGCAAGTACCAAGAATGGCTCCAAATGAGAGACCAATA
TGTGATGAGCTTGGTGATAACATGCCAACTTGGGAGGACAAGGCTTGCTAAATGTTTGAT
ATTTTGAAGTACTGGTATTGCTTCAGACAATTCTTTGAGGCTGTCAAGCTCACTCCAGAA
TAAAAAGAGACTTTACAAAAGAAAAAGTTCATTGACTATGACACTGAATTAAACGAACCC
AAATATCTCACATTTTCATAGTTATACGAAAAAGTTGATAATAATGAGAAAACTTGCATT
TACTTAACATATGAGCATCTTTATGAAGAAATAAAGACAACCTTGAATGTATTTGCCAAG
GGACTTGATAAGAGAGATCAGACTGGCATGTGTGCAAGAGCTAGTTTACTAATTCTTGAG
AAACTTCTTGAAGAAAATGAGATCTTCTAATATATCAAACCATCAAAGAAAAAGATAAAT
TACAGAGCAAATCAGCAGCTAGCAGCCGATTAAAGAAATTAAAATGATAACACTGATTAA
AACATGTTAAGCAGCAAATTGTCATCACCATAGAAATCTCCTGCTAAAAAGAATAATAAC
AGAAATAGTGGAAGCAATAACGAAGAAAATGATGTTTAAATAGACATCTCTGAACAGGAA
AACGATTATGATGAGGAGGAGGAATTCGATCAAGAGCACAGTGATGACGAGGAGTATTTC
AGTGATATCCCCAAGAATGAGTTGAAAGTTGCTAATGAGGAGTAAAAGAAGAACAGTGGA
AGAATATCAACAAGAAGAAACAAACCAATTAAGAATGAAAAGAAACACATTGAACCAAAC
AATGACTATGACTTCGATCTTAATGAGGATTAAAATCAAAACAGCAATATGCAAAACTTC
TTCTAGATTGAAGCAGAGCATTCTGACGTTGTGATAAATCTTGATTAAGATTCTAATCAA
CTCCCCTTCTCTTTATAGTCATTGGTAAACAAATCGGTTAATTTGACACCATCTAAGGTT
AATTAGAATGAGGGAAGTGTGAGTGTTGGAGGGAGAGTGACAAGAAACAGGTTGAGAGGT
CTGTAGGCAAACTAAAACTAGAATTGA


>Contig20936.0.g51(protein)
MLFDVERYVAEMEDLRKIQQLKPPNNKVPAVNLSKLSFDKKVAPITLDIRFGDKFILRDK
FDWDLMEPRLRPQDFARAMCNQLPFFKSDQEKDVAIEKMSNSILDQIQAHIDKNTFFPRV
RFGKKEEDTIANDQVCVNCDSLLLNSETCAHCGFQYEKKPGPQPGPGTQMPESMKNERKE
GNQNKIDIQDAFKKPANIGLEQKSQRIQESKKLNQDDQIQEEQPVQVIHVFKVPENPIEG
QKQRPQTNTNLSWKDRLTGDYVFSGKEKKICKKCNEVNPFFKNECQKCTYKFPKTRGLNS
SLNADNYTLYFWDMLHSEPIFSSLSKINDYLQESDFISVRDLYKKIKEILTQPNTERIFD
ITDIQLLELHDSIDEKFEWLLTDNELTDRIFNDATAQKTNRKRTKQVYYNFKDAQQVHDR
KVLGMEDFQSNNFQNDDSFENPYKRLKAGNENYQQIQKQRPHNFESVKMQSIISNYNLLS
QMGFLEQSVIQSETINKLVNEQEEIISSLIKRRGRPKKFDLTYEDMLNVEKWDDSKLVFQ
TGLPGLGGEKDEDGNDQGGAQGAGTSTGTKRNVDLNADVCGICDLPGKLICCDDCPSAFH
ADCLGYEKQCPRGKWKCYFCKVIKYGIRQVPRMAPNERPICDELGDNMPTWEDKACQMFD
ILKYWYCFRQFFEAVKLTPEQKETLQKKKFIDYDTELNEPKYLTFSQLYEKVDNNEKTCI
YLTYEHLYEEIKTTLNVFAKGLDKRDQTGMCARASLLILEKLLEENEIFQYIKPSKKKIN
YRANQQLAADQRNQNDNTDQNMLSSKLSSPQKSPAKKNNNRNSGSNNEENDVQIDISEQE
NDYDEEEEFDQEHSDDEEYFSDIPKNELKVANEEQKKNSGRISTRRNKPIKNEKKHIEPN
NDYDFDLNEDQNQNSNMQNFFQIEAEHSDVVINLDQDSNQLPFSLQSLVNKSVNLTPSKV
NQNEGSVSVGGRVTRNRLRGLQANQNQN