Identifiers and Description

Gene Model Identifier

Contig20611.0.g28

Standard Name

RCO1a

Aliases

Contig20611_0_g28

Description

PHD-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007664401.999598840915195e-17PHD-finger family protein
SGDYMR075W0.000000004999139696582238RCO1 SGDID:S000004680, Chr XII
I from 413982-416036, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20611.0.g28(coding)
ATGGAGTCCAATAGACAAACTAAGTTGCAAGAATCTGCAAAGAATGGGAGTGGCAACGAC
CGATCCAAAACACCCACCACTTAATCACCCAGAGACCAAAGAAAGAATACCAATGTCAAG
TTGGAATAAGAGGAACAAAAAGGTAGTAGAAGAGACGCCACACCTCAGAAAGCTCAAATA
AACAGTTCTGGCTAAAAGATCAAAGAACCCACAAAGTCAGCAAGAAAGAATTCATAGAGT
ATTGATAAATCTGCTTAAAAGGCAAAGAAAGGCCCTCAATCATAAAGTATGAATATTTCT
TCACAAGCCAGGAGCAGTCAAGATTTTGGAAATGATGAAACTGGTGAGTTAAGGCAGAAT
AGAGACCACTGCAACATTTGCAAAGACGGTGGAGATCTACTTTGTTGCGACAATTGTCCA
AGATCTTTCCATACCAAGTGTGTGGGGTTAAAGTCTATCCCTGAAGATGATTGGTATTGC
AAACGTTGCGTACCCATTATGGATAAGAGAAAGCATACTGATGAAGAAAAACGTAAGAGA
GCTCAAGAAAGAGAGAAAATTCTAGAAGATAAAAGGTTGTAGAAAGAGCGGGAAAATAGA
GAGAAGGAATAAGAGTTTGAGAAAAAGAGAGAGGAAAAGAGATTAGAGAAAGAGAGACAA
GAGGAAGAAAAGCAAAAGATCAGATAGTAGAAACTTGATGAGATTGCTGCACAAAAGGCA
TAGAAACAAGCTGAATTGTTAGCATAACAAGAAGAAAAAAGATTGAAACTCGAGCAAGAA
AAACAAGAAAAGTCATAGTTAATAGAACAGTAGAGATTGCAAAAGCTCGAAGAAAAGTAG
AAATTACAGGAGTAGAAGTAGCAAGAGATGGAGCAGAAAAAGCAGCAGCTACTACTAGTT
AAAAATGATAAATCACGACAAAAGAGTCAGTCTTCTGGTGTCAGCTCATAACAGGGAGTT
AAAATTGAAAACGATTCTAAGAGTATAAGCCCTTTTAGAAATGGCAGGCCAAGTGGCAAG
TAATCACCTGCTAGAGAGGAAGGAGTACAGGAAGATAATGGAGCAAATGAATAGTAGAAT
CTAGATCAATAAACAGCCAATGTTACTCAAGTGATTAGTCAGCCAAAGAAATAACCAGTG
AAAGGACAAGCAAATGGAGGAATCCCCTCAAACTAAAAGAAGTCTGAGGAGAAATCAGAG
GCTGAAAAGGCTAAAGAAGCAAGAGCAAGAGAAATGAAAACACAGTTGAAGATATTTGCC
AGAATTTATCCAGAATTGGTTGAAAAGCATTCAATTAAATACCCTATTGAGGATAAGCTC
ATAAAGAAAATGCCATTACTTCATGGTGCAGATAACTTCCCATAGAAACCTCAGCTGAAG
CAAGTACTGCTTAATGGTCCTTAATTTGAAAGACTCCTCTATATTTGGGAGTTCTTAAAC
AACTTTGGAGACTTCATGAATCTGACACCATTCAAGTTTGAAGAACTTTAAATAGCATTA
AGCTTTACTTAGAGAAATGATTAAGTGCAGTTATACAGTCAGCCAGAGAATCCAGACGAG
GAGCCAGATTGGGAGCATCAGATTAACAACAAGACAGTCTCAGAACAAGGATTTGGACTT
ATTAACTCAATTCATGTTTCCATCTACAATGTTTTCATGAATGAACTGAAGCATCTTGAG
GAGAAAACCAAAGCTGCTAATGAAGCTTCAAATAAGGAGAACATAGATGAAGAAGAGGAC
AATCTTATTGAAGAAATCAGAAAGACTGTTGATAAGCCTGAGAATATCTGGCCAGAACTC
ATTAGACTGATTATGAAATAATAGAAGAGATTCGATTTCTACCCATTAGATCAGCATATT
GCTTCAATCTGTGATAAATTGGCAACATGTTCCCCAGAGTCATACTCAAACAAATTGACT
TACGAGGAGAAAACAGAACTCTTAGAAGTGCTTATTGATGGTATCCATGATCTAGATGAT
TTTAGAGTATTTTTGAATCAGAGAGTTGAAGAGAAATCCTCATTTAACAAGCAAAAGATG
GATATCTATGCTGAGATAAAGCAATTGGAAAACTAAAAGCAGGAAATCGTTAAAGAACAT
GCTTAAAACAATTTCTTCAATAACTCAGAGGAAATTTTGAACAAAATTGACGAATTGAAA
AAGTAGCTTGCTGGGGCTACTCGTATCTAAAGTAGAACAATATGGAATTAGATCAATGAG
CTACAGAGTGAGAAGAATAAGATCCTCAAGGAAATGTAGAAGATCGAAGATCAAATTGAA
AAGAGACAAAATAAGATTGAGAGATTGAATGAACAAGCTCACAAAACTTCAATTAAGACT
TCAATGCTTGGTAAAGACGCAGATAAGAACGAATATTGGTTCTTCAAGGAGGAACCTGGC
AAGCTATTTGTCAAGAAATATGAAGAAGTTAAAAACTAAAAACCTGTAACTCAAGATGTT
CAAATGGTCGACGAGGAGTAAATTAACACTGATACAATTAAGTAGTAGGATTAGCAAATG
CATGAGGATGAATTTGATGCTGAAGCAATAGAAGTCATTTTCAAATGGTACTACTATGAT
CAAGAAGAAGAGTTTGAACGTCTAATTGAGGCTTGTAATCTTAAGGGAATAAGAGAGAGA
AAGCTTTAAGAGAACCTTAGAAAGATAAGAGACAGACTTAAGCTAAAGAAGAGCAGAAAG
TAAGCCGCCGCAGCTGCTGCTGCCGCCACCCAAGCAAATGCATTAGGCGATTAACTTAAG
CAGGAAGAAGTCTCTTAGGATATGAAAGAAGAAACCGCAGTACAAGAATAGTAGAAAAAG
GAAGATATTGAAATGGAAGAAGAAGAGGTTGAAGAAGTTCAGGAAAAAAAGCATGTCATC
TTCGAAAATGATAACTACTATCAAGCTTTGAATAATTCAATATGGTACAACAAAAAGATG
CCAACCAAGAGACAGTATCTTATGGAAAATAAGGCAATGCCTTCAAGAGGTGGTAGGGGT
GTTTAGCAAAAGTAACCTTATCCTTAAGAAGAAAAGATAACCTTTGAGAATGTGAAACAG
TAACTTCTCGGACTAGAAGAGCTATACACAGATTCAAATCTGTAATTTCAGAGAGAATGG
GACTTCAAACATGTGAGAGATAAAGTAAAAGAGTAAATTTTCGAGGCTCAAACTGTAGAC
GATTTATCTTAAGTTCTCCTTAAATTAGACGAAGGTTTCTGTTCTCCACACTCATTAAAA
TATGTGAATAACAAAGATGATCAGGATTAGTAGAACAATGACCAAGAAGACGAAGAAGGA
GGCAACTAAAGTGAATTTATCAAAGATCAAAATGAAGAGAGCAAGAATATCAATGATGGA
GAAAACGGATTAGACAAAAATGTCAAAGTATAGAAGCTGTTTTTCATTAAGTTCTGGGCT
ACAAAAGAGTTGAGAGAATCCTGGAGATAATATGTATTTGGTGAATGCTGCTTTGGAAAC
GTGAATGCTCTATTTATCGCAGTGAAAATCCTAGAGAAAACTGTTGGTTAATCTATCTAG
AGGTCTTTAGACGCTTAGTACAAGAAGCAAAAGAAAGAGCAAGCCAAGCAGGGATAGACC
AGAGGAGGAGCTCAACCCTCTACAAAAATGTAGAACTAACAAGATAAGTCAGCAAGCAGA
AAGAGTAAAAGTTACAAGTAGTTCTTTGACGACGAAGAGGACGATGATTCAGAGGATGAG
AGATCTAATGAGCGAAGCCGCAGAAGTGCTAAACCTGCAGCTAAAGCAAAGTCTAAAGGT
GGCAAAAAGAAGATGTATCTAGAGAGCGATGATGAATCAGATTTGGACTCAATGCAAGGA
GAAAGTGAAGTGGATGAAGATGAAGTTGATGAGGAAGATGATGATGAAGAGAGCAAGTAA
TGGGATGAAGCTTGTTACAAGTGTAACAAGGGTGGAAAGGTTTTATGCTGTGAGTCTTGC
AATCATGTCTGTCATTTGAGTTGTTCAGGACTCTTGAAGAAGCCTCTTGATGAATGGCAT
TGCGAAGAGTGTCTCATTCAGTAAACTAGAAAGAGAACCACTAGAGGCACTACCAACCTT
TATATTAAACCCAAGAATTAAATTGGTGGAAGATATAGATGA


>Contig20611.0.g28(protein)
MESNRQTKLQESAKNGSGNDRSKTPTTQSPRDQRKNTNVKLEQEEQKGSRRDATPQKAQI
NSSGQKIKEPTKSARKNSQSIDKSAQKAKKGPQSQSMNISSQARSSQDFGNDETGELRQN
RDHCNICKDGGDLLCCDNCPRSFHTKCVGLKSIPEDDWYCKRCVPIMDKRKHTDEEKRKR
AQEREKILEDKRLQKERENREKEQEFEKKREEKRLEKERQEEEKQKIRQQKLDEIAAQKA
QKQAELLAQQEEKRLKLEQEKQEKSQLIEQQRLQKLEEKQKLQEQKQQEMEQKKQQLLLV
KNDKSRQKSQSSGVSSQQGVKIENDSKSISPFRNGRPSGKQSPAREEGVQEDNGANEQQN
LDQQTANVTQVISQPKKQPVKGQANGGIPSNQKKSEEKSEAEKAKEARAREMKTQLKIFA
RIYPELVEKHSIKYPIEDKLIKKMPLLHGADNFPQKPQLKQVLLNGPQFERLLYIWEFLN
NFGDFMNLTPFKFEELQIALSFTQRNDQVQLYSQPENPDEEPDWEHQINNKTVSEQGFGL
INSIHVSIYNVFMNELKHLEEKTKAANEASNKENIDEEEDNLIEEIRKTVDKPENIWPEL
IRLIMKQQKRFDFYPLDQHIASICDKLATCSPESYSNKLTYEEKTELLEVLIDGIHDLDD
FRVFLNQRVEEKSSFNKQKMDIYAEIKQLENQKQEIVKEHAQNNFFNNSEEILNKIDELK
KQLAGATRIQSRTIWNQINELQSEKNKILKEMQKIEDQIEKRQNKIERLNEQAHKTSIKT
SMLGKDADKNEYWFFKEEPGKLFVKKYEEVKNQKPVTQDVQMVDEEQINTDTIKQQDQQM
HEDEFDAEAIEVIFKWYYYDQEEEFERLIEACNLKGIRERKLQENLRKIRDRLKLKKSRK
QAAAAAAAATQANALGDQLKQEEVSQDMKEETAVQEQQKKEDIEMEEEEVEEVQEKKHVI
FENDNYYQALNNSIWYNKKMPTKRQYLMENKAMPSRGGRGVQQKQPYPQEEKITFENVKQ
QLLGLEELYTDSNLQFQREWDFKHVRDKVKEQIFEAQTVDDLSQVLLKLDEGFCSPHSLK
YVNNKDDQDQQNNDQEDEEGGNQSEFIKDQNEESKNINDGENGLDKNVKVQKLFFIKFWA
TKELRESWRQYVFGECCFGNVNALFIAVKILEKTVGQSIQRSLDAQYKKQKKEQAKQGQT
RGGAQPSTKMQNQQDKSASRKSKSYKQFFDDEEDDDSEDERSNERSRRSAKPAAKAKSKG
GKKKMYLESDDESDLDSMQGESEVDEDEVDEEDDDEESKQWDEACYKCNKGGKVLCCESC
NHVCHLSCSGLLKKPLDEWHCEECLIQQTRKRTTRGTTNLYIKPKNQIGGRYR